Recombinant Staphylococcus aureus Probable CtpA-like serine protease (SAV1420)

Shipped with Ice Packs
In Stock

Description

Introduction to CtpA and SAV1420

CtpA (C-terminal processing protease A) is a serine protease belonging to the S41 family, first characterized in Staphylococcus aureus as a virulence factor critical for stress tolerance, immune evasion, and cell-wall stability . The ctpA gene (SAV1420 in S. aureus strain Mu50) encodes a protein with a conserved catalytic dyad (Ser-Lys) and unique domains, including a peptidoglycan-binding motif specific to Gram-positive bacteria . Recombinant SAV1420 is produced via heterologous expression in Escherichia coli systems, enabling biochemical and functional studies of this enzyme .

Functional Role in S. aureus Pathogenesis

SAV1420 contributes to virulence through:

  • Stress Tolerance: ctpA mutants exhibit reduced heat resistance and increased susceptibility to host immune components (e.g., defensins) .

  • Immune Evasion: Upregulated in human serum and during intracellular infection, enhancing survival in hostile environments .

  • Virulence in Murine Models:

    • Survival rates increased from ~10% (wild-type infection) to ~90% in ctpA⁻ mutant-infected mice .

    • Bacterial burden in organs (e.g., spleen, brain) reduced by 28- to 228-fold in mutant strains .

Key Studies

  • Protease Activity: SAV1420 processes substrates critical for cell-wall integrity, though specific targets remain unidentified .

  • Immunogenicity: Associated with pro-inflammatory responses in S. aureus infections (Table 1) .

Table 1: Proteins Correlated with Pro-Inflammatory Phenotypes in S. aureus

GeneProteinCorrelation (r)Adjusted p-value
SAV1420Probable CtpA-like serine protease0.660.0046
hlaAlpha-hemolysin0.730.00066
sarATranscriptional regulator SarA0.760.00032

Potential Applications

  • Therapeutic Target: Inhibition of CtpA could attenuate S. aureus virulence .

  • Vaccine Development: While not yet tested in vaccines, its role in pathogenesis makes it a candidate for inclusion in multi-antigen formulations .

Comparative Analysis with Other Proteases

FeatureSAV1420 (Gram-positive)Gram-negative CtpA
Peptidoglycan BindingYes (C-terminal domain) No
LocalizationCell wall Periplasm
Role in VirulenceCritical for sepsis and pneumoniaModulates σ factor signaling

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
SAV1420; Probable CtpA-like serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-496
Protein Length
full length protein
Species
Staphylococcus aureus (strain Mu50 / ATCC 700699)
Target Names
SAV1420
Target Protein Sequence
MDDKQHTSSSDDERAEIATSNQDQETNSSKRVHLKRWQFISILIGTTLITAVITVVAYIF INQKISGLNKTDQANLNKIENVYKILNSDYYKKQDSDKLSKAAIDGMVKELKDPYSEYLT KEQTKSFNEGVSGDFVGIGAEMQKKNDQIMVTSPMKGSPAERAGIRPKDVITKVNGKSIK GKALDEVVKDVRGKENTEVTLTVQRGSEEKDVKIKREKIHVKSVDYKKKGKVGVITINKF QNDTSGELKDAVLKAHKDGLKKIVLDLRNNPGGLLDEAVKMANIFIDKGKTVVKLEKGKD TEAIQTSNDSLKEAKDMDISILVNEGSASASEVFTGALKDYNKAKVYGSKTFGKGVVQTT REFKDGSLLKYTEMKWLTPDGHYIHGKGIKPDVTIDTPKYQSLNVIPNTKTFKVGDDDKN IKTIKIGLSALGYKVDNESTQFDQALENQVKAFQQANKLEVTGEFNKETNNKFTELLVEK ANKHDDVLDKLINILK
Uniprot No.

Target Background

Database Links

KEGG: sav:SAV1420

STRING: 158878.SAV1420

Protein Families
Peptidase S41A family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the CtpA protease in Staphylococcus aureus and what is its significance?

CtpA in Staphylococcus aureus is a C-terminal processing protease belonging to the S41 family of serine proteases. It represents the lone C-terminal processing protease identified in S. aureus and is highly conserved across all sequenced strains, suggesting it plays a critical role in cell physiology. The significance of CtpA lies in its contribution to bacterial survival under stress conditions and its role in pathogenesis. It has been demonstrated that CtpA is required for S. aureus virulence, marking the first characterization of a C-terminal processing protease as a virulence factor in a pathogenic Gram-positive bacterium . Understanding CtpA is particularly important given the rise and spread of multidrug-resistant S. aureus strains, which present an ongoing public health concern.

What is the structural organization of S. aureus CtpA?

The S. aureus CtpA protease exhibits a multi-domain organization typical of S41 family proteases but with distinct features. Domain analysis reveals three major structural components:

  • A protein-binding PDZ domain located between amino acid residues 135 and 218

  • An S41 CTP peptidase domain between residues 231 and 395, which contains the catalytic dyad

  • A peptidoglycan binding domain between residues 417 and 473

This peptidoglycan binding domain is particularly noteworthy as it is exclusively found in CTPs from Gram-positive bacteria and absent in those from Gram-negative bacteria. This structural feature suggests a unique role for CtpA in the cell wall architecture of Gram-positive bacteria like S. aureus . Multiple sequence alignment with other S41 family members reveals a highly conserved region between residues 321 and 395, which comprises the catalytic site, indicating enzymatic conservation with other S41 family members despite substrate variability.

Where is CtpA localized in S. aureus cells and how is this determined?

CtpA in S. aureus is localized to the bacterial cell wall, which aligns with its structural features, particularly the presence of a peptidoglycan binding domain. This localization has been experimentally determined and suggests that CtpA plays a role in maintaining cell wall stability and integrity in S. aureus . The cell wall localization is consistent with the observed phenotypes of ctpA mutants, which show increased sensitivity to stress conditions and host immune components. Researchers typically determine protein localization through a combination of fractionation studies, immunolocalization, and functional analysis of domain-specific mutants. The presence of the peptidoglycan binding domain provides strong evidence for the cell wall being the primary site of CtpA activity in S. aureus.

How is the ctpA gene expression regulated in S. aureus?

The expression of ctpA in S. aureus follows a complex regulatory pattern that varies significantly with growth phase and environmental conditions. Key patterns of expression include:

  • Growth phase dependency: Expression is minimal during early exponential phase and increases dramatically during late exponential and stationary phases

  • Induction in human serum: Expression increases approximately 2.8-fold after 1 hour in human serum, followed by dramatic increases of 41-fold at 2 hours and over 1700-fold at 3 hours

  • Intracellular induction: When S. aureus is phagocytosed by RAW246.7 cells, ctpA expression increases 345-fold at 3 hours, 661-fold at 6 hours, and 1462-fold at 24 hours post-infection

This expression pattern strongly suggests that CtpA is particularly important during infection and exposure to host defense mechanisms. The massive upregulation observed in human serum and within phagocytic cells indicates that CtpA likely plays a critical role in bacterial survival within the host environment.

What are the phenotypic consequences of ctpA disruption in S. aureus?

Disruption of the ctpA gene in S. aureus leads to multiple phenotypic changes that provide insights into its functional roles:

Phenotypic ChangeExperimental EvidenceFunctional Implication
Decreased heat toleranceReduced survival at elevated temperaturesRole in stress response and protein quality control
Increased sensitivity to immune componentsGreater susceptibility to host defense mechanismsFunction in infection and immune evasion
Altered cell wall stabilityChanges in response to cell wall-targeting antibioticsMaintenance of cell envelope integrity
Attenuated virulenceReduced pathogenicity in murine infection modelsDirect contribution to pathogenesis

These phenotypic changes demonstrate that CtpA functions extend beyond mere protein processing to include critical roles in stress tolerance, cell wall maintenance, and virulence . The attenuated virulence of ctpA mutants in animal models provides compelling evidence for CtpA as a potential target for novel anti-staphylococcal therapeutics.

How does CtpA contribute to S. aureus virulence mechanisms?

CtpA contributes to S. aureus virulence through multiple mechanisms, making it an important virulence factor. Research has demonstrated that a ctpA mutant strain is significantly attenuated for virulence in a murine model of sepsis . The specific mechanisms through which CtpA enhances virulence include:

  • Maintenance of cell wall integrity during infection, which helps the bacterium withstand host-generated stresses

  • Enhanced survival within phagocytic cells, as evidenced by the dramatic upregulation of ctpA expression after phagocytosis

  • Potential processing of virulence-associated proteins, although specific substrates remain to be fully characterized

  • Contribution to stress tolerance, particularly against components of the host immune system

These mechanisms collectively suggest that CtpA plays a multifaceted role in S. aureus pathogenesis by enhancing bacterial survival and persistence within the host environment. The significant attenuation of virulence observed in ctpA mutants provides compelling evidence for its importance in the disease process.

What experimental approaches are most effective for studying CtpA function in S. aureus?

Multiple experimental approaches have proven effective for investigating CtpA function in S. aureus:

  • Genetic manipulation: Creation of ctpA knockout mutants through targeted mutagenesis allows for phenotypic characterization and virulence assessment

  • Reporter fusion studies: Construction of ctpA-lacZ reporter fusions enables detailed analysis of gene expression under various environmental conditions

  • Infection models: Both in vitro cell culture systems (e.g., RAW246.7 macrophages) and in vivo murine models provide insights into CtpA's role during infection

  • Stress tolerance assays: Evaluating bacterial survival under various stress conditions (heat, antimicrobial peptides, antibiotics) reveals functions in stress response

  • Biochemical approaches: Purification of recombinant CtpA for in vitro activity assays and substrate identification

A comprehensive understanding of CtpA function requires the integration of multiple methodological approaches. The combination of genetic, biochemical, and infection models has proven particularly powerful for elucidating the diverse roles of this protease in S. aureus biology and pathogenesis.

How does CtpA expression change under infection-relevant conditions?

CtpA expression undergoes dramatic changes when S. aureus encounters conditions relevant to infection. These expression patterns provide important insights into the protein's role during pathogenesis:

ConditionFold Change in ExpressionTime PointImplication
Human serum exposure2.8-fold increase1 hourEarly adaptation to host environment
Human serum exposure41-fold increase2 hoursProgressive adaptation
Human serum exposure1704-fold increase3 hoursMaximal expression during established infection
Human serum exposure1124-fold increase4 hoursSustained high-level expression
Intracellular (phagocytosed)345-fold increase3 hoursEarly response to phagocytosis
Intracellular (phagocytosed)661-fold increase6 hoursContinued adaptation
Intracellular (phagocytosed)1462-fold increase24 hoursLong-term survival strategy

These expression patterns clearly demonstrate that CtpA is highly induced under infection-relevant conditions, with some of the most dramatic increases (>1000-fold) occurring in environments that mimic those encountered during infection . Such expression patterns strongly suggest that CtpA plays a critical role in helping S. aureus adapt to and survive within the host environment.

What are the differences between S. aureus CtpA and similar proteases in other bacterial species?

Comparative analysis reveals both similarities and important differences between S. aureus CtpA and related proteases in other bacteria:

  • Domain organization: S. aureus CtpA shares the core PDZ and S41 protease domains with other bacterial CTPs, but specifically contains a peptidoglycan binding domain that is exclusive to Gram-positive bacteria and absent in Gram-negative CTPs

  • Sequence conservation: Multiple sequence alignment with S41 family members from various bacteria shows high conservation specifically in the catalytic domain (residues 321-395), but less homology in other regions, suggesting substrate specificity differences

  • Functional roles: While CTPs in Gram-negative bacteria like E. coli have been implicated in stress tolerance, S. aureus CtpA appears to have evolved additional roles in maintaining cell wall stability and virulence that may be unique to Gram-positive pathogens

  • Number of CTP homologs: Unlike some bacteria that possess multiple CTP family members (e.g., B. subtilis has both CtpA and CtpB), S. aureus contains only a single CTP, suggesting potential functional consolidation

These differences highlight the specialized evolution of CtpA in S. aureus, particularly its adaptation to the distinct cell envelope architecture of Gram-positive bacteria and its expanded role in virulence.

What methodological approaches can be used to identify the specific substrates of CtpA?

Identifying the specific substrates of CtpA remains a significant research challenge. Several methodological approaches can be employed:

  • Comparative proteomics: Analysis of protein profiles between wild-type and ctpA mutant strains using techniques such as 2D-PAGE or quantitative mass spectrometry to identify proteins with altered processing

  • Substrate trapping: Generation of catalytically inactive CtpA mutants that can bind but not process substrates, followed by co-immunoprecipitation and mass spectrometry

  • In vitro processing assays: Incubation of purified recombinant CtpA with candidate substrate proteins and analysis of processing by mass spectrometry or SDS-PAGE

  • Terminal amine isotopic labeling of substrates (TAILS): This specialized proteomics approach can identify proteins with modified C-termini that may represent CtpA substrates

  • Bioinformatic prediction: Analysis of the S. aureus proteome for proteins with sequence motifs that match known CTP recognition sites from other bacterial species

Implementing these complementary approaches would significantly advance our understanding of CtpA's substrate repertoire and provide deeper insights into its diverse cellular functions in S. aureus.

How might CtpA be targeted for potential therapeutic development?

Given the importance of CtpA for S. aureus virulence and stress tolerance, it represents a promising target for novel anti-staphylococcal therapeutics. Several approaches could be explored:

  • Small molecule inhibitors: Design of specific inhibitors targeting the catalytic site within the S41 domain, leveraging the high conservation of this region across S41 family members

  • Peptide-based inhibitors: Development of peptides that mimic CtpA substrates but include non-cleavable bonds or modifications that prevent processing

  • Disruption of localization: Compounds that interfere with the peptidoglycan binding domain could prevent proper localization to the cell wall, potentially reducing virulence

  • Structure-based drug design: Determination of the three-dimensional structure of S. aureus CtpA would facilitate rational design of inhibitors with high specificity

  • Vaccine development: As a cell wall-associated protein important for virulence, CtpA could potentially be included in multi-component vaccines against S. aureus, similar to other recombinant antigen approaches

The attenuated virulence of ctpA mutants in animal models suggests that effective inhibition of this protease could significantly reduce S. aureus pathogenicity. This makes CtpA an attractive target for addressing the growing concern of antibiotic-resistant S. aureus infections.

What role might CtpA play in S. aureus vaccine development strategies?

CtpA could contribute to S. aureus vaccine development in multiple ways:

  • As a vaccine antigen: The cell wall localization of CtpA makes it potentially accessible to antibodies, and its conservation across S. aureus strains suggests it could provide broad protection

  • As part of multi-component vaccines: Recent approaches to S. aureus vaccines have focused on combining multiple antigens to enhance efficacy, as demonstrated by the recombinant five-antigen S. aureus vaccine (rFSAV) studied in clinical trials

  • As a processing enzyme for other antigens: If CtpA processes other surface proteins important for virulence, inhibiting it could enhance the efficacy of vaccines targeting those proteins

  • Understanding immune responses: Studies of immune responses to CtpA during infection could provide insights into protective immunity against S. aureus

Vaccines are urgently required to control S. aureus hospital and community infections and reduce antibiotic use . The development of vaccines incorporating or targeting CtpA could complement existing approaches by addressing a protein with demonstrated importance for virulence.

What are the most promising areas for future research on CtpA in S. aureus?

Several research directions hold particular promise for advancing our understanding of CtpA:

  • Substrate identification: Comprehensive identification of CtpA substrates would significantly clarify its cellular functions and potential as a therapeutic target

  • Structural characterization: Determination of the three-dimensional structure of S. aureus CtpA would facilitate understanding of its mechanism and enable structure-based drug design

  • Regulation mechanisms: Further investigation of the regulatory networks controlling ctpA expression could reveal how S. aureus modulates this protease during infection

  • Role in antibiotic resistance: Exploration of potential connections between CtpA function and antibiotic resistance mechanisms, particularly those involving cell wall modifications

  • Host-pathogen interactions: Deeper investigation of how CtpA contributes to evasion of host immune defenses, particularly within phagocytic cells where its expression is dramatically induced

  • Animal models: Development of improved animal models to better understand the role of CtpA in different types of S. aureus infections

These research directions would collectively enhance our fundamental understanding of this important virulence factor while potentially opening new avenues for therapeutic intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.