Recombinant Staphylococcus aureus Probable quinol oxidase subunit 3 (qoxC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
qoxC; SAOUHSC_01000; Probable quinol oxidase subunit 3; Quinol oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Staphylococcus aureus (strain NCTC 8325)
Target Names
qoxC
Target Protein Sequence
MSHDTNTIDSRTHEGELNKLGFWIFITAEFALFGTLFATLLTLQHGGDYAGKMTTELFEL PLVLIMTFALLFSSYTCGIAIYYMRQEKQKLMMFWMIITLLLGLVFVGFEIYEFAHYASE GVNPTIGSYWSSFFILLGTHGCHVSLGIVWAICLLIQIQRRGLDKYNAPKLFIVSLYWHF LDVVWVFIFTAVYMIGMVYSG
Uniprot No.

Target Background

Function
Catalyzes quinol oxidation with the concomitant reduction of oxygen to water.
Database Links
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of quinol oxidase subunit 3 (qoxC) in Staphylococcus aureus?

Quinol oxidase subunit 3 (qoxC) is a component of the cytochrome aa3 quinol oxidase complex in S. aureus, which plays a crucial role in the respiratory electron transport chain. This membrane-bound protein complex transfers electrons from quinol to oxygen, contributing to energy production and bacterial survival. The qoxC subunit specifically functions as a membrane-anchoring component and participates in proton translocation during the respiratory process .

How do I optimize solubilization conditions for recombinant qoxC?

Successful solubilization of membrane proteins like qoxC requires systematic testing of detergent conditions:

Detergent ClassExamplesConcentration RangeBest For
Non-ionicDDM, Triton X-1000.5-2%Initial screening
ZwitterionicLDAO, CHAPS0.5-1%Higher resolution studies
Steroid-basedDigitonin0.5-1%Maintaining protein-protein interactions

Begin with milder detergents (DDM or Triton X-100) for initial extraction, then test various detergent types, concentrations, and buffer conditions (pH 6.5-8.0, NaCl 150-500 mM). Optimize temperature (typically 4°C for membrane proteins) and incubation time (2-16 hours). Verify solubilization efficiency using Western blot analysis with anti-His or specific qoxC antibodies .

What purification strategies yield the highest purity of recombinant qoxC?

For recombinant qoxC with affinity tags, a multi-step purification approach is recommended:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or TALON resin as the initial capture step

  • Size exclusion chromatography to separate monomeric from aggregated protein

  • Ion exchange chromatography as a polishing step

Maintain detergent above critical micelle concentration throughout purification to prevent protein aggregation. For membrane proteins like qoxC, adding a lipid (e.g., 0.01-0.05% cholesteryl hemisuccinate) to the purification buffers often improves stability. Final purity should be assessed by SDS-PAGE and Western blotting, with functional integrity verified through activity assays .

How can I verify the proper folding and functionality of recombinant qoxC?

Verifying proper folding and functionality of membrane proteins like qoxC requires multiple complementary approaches:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Thermal shift assays to evaluate protein stability in different buffer/detergent conditions

  • Limited proteolysis to examine conformational integrity

  • Functional reconstitution into proteoliposomes followed by quinol oxidase activity assays measuring oxygen consumption

For quinol oxidase activity specifically, reconstitute purified qoxC into liposomes with other quinol oxidase subunits, then measure oxygen consumption using an oxygen electrode in the presence of reduced quinol substrates. Functional protein should show concentration-dependent activity that can be inhibited by specific quinol oxidase inhibitors .

What are the optimal conditions for structural characterization of qoxC?

Structural characterization of membrane proteins like qoxC presents significant challenges. For X-ray crystallography, screen multiple detergents and lipid additives to identify conditions that promote crystal formation. Particular success has been achieved with maltosides (DDM, DM) supplemented with lipids like cholesterol. For cryo-EM studies, reconstitution into nanodiscs using MSP1D1 scaffold proteins and a mixture of POPC/POPE lipids has proven effective for other membrane proteins.

Recent advances in membrane protein structural biology suggest the following approaches for qoxC:

MethodRecommended ConditionsAdvantagesLimitations
X-ray CrystallographyVapor diffusion with 20-30% PEG, pH 6.5-7.5High resolutionChallenging crystallization
Cryo-EMVitrification in thin ice, nanodiscsNative-like environmentLower resolution for small proteins
NMRSelective isotope labeling, detergent micellesDynamic informationSize limitations

For initial screening, thermal stability assays (TSA) using a variety of buffers and additives can help identify conditions that maximize protein stability prior to structural studies .

How can I design experiments to study qoxC interactions with other respiratory chain components?

To characterize protein-protein interactions between qoxC and other respiratory chain components:

  • Co-immunoprecipitation using antibodies against qoxC or epitope tags

  • Biolayer interferometry (BLI) or surface plasmon resonance (SPR) to measure binding kinetics

  • Cross-linking mass spectrometry to identify specific interaction interfaces

  • Bacterial two-hybrid assays for in vivo interaction verification

For more detailed interaction mapping, site-directed mutagenesis of predicted interface residues followed by functional assays can identify critical interaction sites. When expressing mutant constructs, use quantitative RT-PCR to ensure comparable expression levels, as differences in expression can confound interaction study results .

What strategies can resolve contradictory data about qoxC membrane topology?

Membrane topology determination for proteins like qoxC often yields conflicting results. To resolve such contradictions:

  • Employ multiple complementary methods:

    • Cysteine accessibility scanning

    • Fluorescence protease protection assays

    • PhoA/LacZ fusion analysis

    • Cryo-EM structural studies

  • Develop a consensus model by comparing results across methods and computational predictions

  • Validate critical regions using site-directed mutagenesis of charged residues at domain boundaries

When contradictory data persists, consider the possibility of dynamic conformational changes or multiple topological states that may be physiologically relevant. Comparative analysis with homologous proteins from other bacterial species can provide additional insight into conserved topological features .

What controls are essential when studying the role of qoxC in S. aureus virulence?

When investigating qoxC's role in virulence, implement the following experimental controls:

  • Genetic complementation: Include a qoxC knockout strain complemented with wild-type qoxC to ensure phenotypes are specific to qoxC loss

  • Multiple strain backgrounds: Test qoxC mutations in diverse S. aureus clinical isolates (MRSA and MSSA) to account for strain-specific effects

  • Growth rate normalization: Adjust inoculum sizes to compensate for growth differences between wild-type and mutant strains

  • In vitro vs. in vivo correlation: Verify that in vitro phenotypes translate to relevant animal models

For animal infection models, use power calculations to determine appropriate sample sizes and include sham-infected controls. When determining bacterial loads in tissues, normalize to tissue weight and use multiple dilutions to ensure accurate quantification .

How should I design experiments to assess qoxC's role under different oxygen conditions?

To evaluate qoxC's role under varying oxygen conditions:

Oxygen ConditionExperimental SetupMeasurement ParametersControls
AerobicShaking flasks (250 rpm), 5:1 headspace ratioGrowth rate, ATP production, NAD+/NADH ratioWild-type, complemented mutant
MicroaerobicStatic cultures or controlled O₂ (5-10%)Expression of respiratory genes, alternative terminal oxidasesMeasure dissolved O₂ continuously
AnaerobicAnaerobic chamber, pre-reduced mediaFermentation products, redox balanceStrict anaerobic indicators

Use transcriptomics to assess how qoxC expression changes across oxygen gradients and compare with other terminal oxidases. For in vivo relevance, measure oxygen tensions in infected tissues using microelectrodes or phosphorescence quenching methods to correlate with ex vivo bacterial gene expression .

What considerations are important when developing antibodies against qoxC for research applications?

Developing specific antibodies against membrane proteins like qoxC requires careful antigen design:

  • Select antigenic epitopes from hydrophilic loops between transmembrane regions

  • Express and purify recombinant fragments containing these epitopes

  • Alternatively, use synthetic peptides conjugated to carrier proteins

For polyclonal antibodies, immunize at least two animals and pool sera to minimize individual variations. For monoclonal antibodies, screen hybridoma clones against both recombinant protein and native S. aureus membrane fractions.

Validate antibody specificity using:

  • Western blot against wild-type and qoxC knockout strains

  • Immunoprecipitation followed by mass spectrometry

  • Pre-adsorption controls with recombinant antigen

Cross-reactivity with homologous proteins from other staphylococcal species should be assessed for applications involving clinical samples with mixed bacterial populations .

How can systems biology approaches enhance our understanding of qoxC in the context of S. aureus metabolism?

Systems biology approaches provide comprehensive insights into qoxC's role in S. aureus metabolism:

  • Integrate transcriptomic, proteomic, and metabolomic data from wild-type and qoxC mutant strains

  • Construct genome-scale metabolic models incorporating respiratory chain components

  • Use flux balance analysis to predict metabolic adaptations when qoxC is absent

  • Apply machine learning to identify patterns in multi-omics datasets

When implementing these approaches, standardize experimental conditions and data processing pipelines. For metabolic flux analysis, use 13C-labeled substrates and measure isotopologue distributions by GC-MS or LC-MS/MS. Develop computational models that account for the reversibility of reactions and incorporate thermodynamic constraints for more accurate predictions of metabolic flux distributions in the absence of qoxC .

What bioinformatic approaches can identify potential qoxC inhibitors as antimicrobial candidates?

Modern computational approaches can accelerate the identification of potential qoxC inhibitors:

  • Homology modeling based on related bacterial cytochrome oxidases with known structures

  • Molecular dynamics simulations to identify stable binding pockets

  • Virtual screening of compound libraries against predicted binding sites

  • Quantitative structure-activity relationship (QSAR) modeling to optimize lead compounds

For initial validation, employ thermal shift assays to confirm binding and enzyme inhibition assays to verify functional impact. Promising candidates should be assessed for specificity (testing against human cytochrome oxidases) and evaluated for membrane permeability using accumulation assays in intact S. aureus cells.

Computational MethodApplicationOutputValidation Approach
Homology ModelingStructure prediction3D model with confidence scoresRamachandran plots, RMSD to templates
Molecular DynamicsBinding site analysisDynamic pocket identificationConsensus across multiple simulations
Virtual ScreeningLead compound identificationRanked compound list with binding energiesExperimental binding assays
QSARLead optimizationStructure-activity predictionsSynthesize and test derivatives

Cross-validate computational predictions with experimental data and refine models iteratively as new information becomes available .

How can next-generation sequencing approaches be optimized to study qoxC mutations in clinical S. aureus isolates?

To optimize NGS approaches for studying qoxC variations in clinical isolates:

  • Design targeted amplicon sequencing focused on the qoxC gene and its regulatory regions

  • Implement long-read sequencing (Oxford Nanopore or PacBio) to capture structural variations affecting qoxC

  • Develop bioinformatic pipelines specifically optimized for membrane protein gene analysis

For clinical studies involving multiple isolates, use appropriate controls:

  • Include reference strains with known qoxC sequences

  • Process duplicate samples to assess technical variability

  • Validate significant mutations by Sanger sequencing

When analyzing sequence data, distinguish between synonymous and non-synonymous mutations, and assess their potential impact on protein function using prediction tools such as PROVEAN or SIFT. For regulatory region mutations, use reporter gene assays to validate their effect on expression levels .

What are the best approaches to develop qoxC as a potential vaccine antigen against S. aureus?

Developing membrane proteins like qoxC as vaccine antigens presents unique challenges. Consider the following approaches:

  • Identify surface-exposed epitopes using a combination of structural modeling and accessibility studies

  • Express these epitopes as recombinant fusion proteins with immunogenic carriers

  • Test multiple adjuvant formulations to enhance immune response against membrane antigens

  • Evaluate antibody functionality beyond titer (opsonophagocytic activity, neutralization)

In animal models, measure both humoral and cellular immune responses, as both may be critical for protection against S. aureus. When designing vaccines, consider combining qoxC epitopes with other S. aureus antigens to create multi-component vaccines, which have shown greater promise than single-antigen approaches.

Key considerations for qoxC-based vaccine development:

  • Express recombinant fragments without transmembrane regions to improve solubility

  • Focus on conserved epitopes to provide broad protection across clinical isolates

  • Assess cross-reactivity with human proteins to avoid autoimmune responses

  • Consider the impact of S. aureus strain variation on antigen recognition

Monitor vaccine efficacy using appropriate challenge models that reflect different types of S. aureus infections (sepsis, pneumonia, skin infection) .

How can I troubleshoot poor expression yields of recombinant qoxC?

Poor expression of membrane proteins like qoxC is a common challenge. Systematic troubleshooting should include:

  • Expression construct optimization:

    • Codon optimization for the expression host

    • Testing different fusion tags (His, MBP, SUMO)

    • Adjusting the promoter strength

  • Host strain selection:

    • C41(DE3) or C43(DE3) for toxic membrane proteins

    • Rosetta strains for rare codon usage

    • SHuffle strains for disulfide bond formation

  • Expression condition optimization:

    • Lower induction temperature (16-25°C)

    • Reduced inducer concentration

    • Extended expression time (24-48 hours)

If expression remains problematic, consider cell-free expression systems or expressing individual domains separately. For transmembrane proteins, incorporating specific lipids into expression media can sometimes improve folding and stability .

What strategies address protein aggregation during purification of recombinant qoxC?

Protein aggregation during purification of membrane proteins like qoxC can be addressed through multiple strategies:

  • Optimize solubilization conditions:

    • Screen different detergents (from harsh to mild)

    • Add stabilizing agents (glycerol, specific lipids)

    • Include reducing agents if cysteine residues are present

  • Modify purification protocols:

    • Use gradient elution rather than step elution

    • Include detergent in all purification buffers

    • Maintain low protein concentration during concentration steps

  • Apply protein engineering approaches:

    • Remove aggregation-prone regions

    • Introduce stabilizing mutations

    • Create fusion constructs with solubility-enhancing partners

Monitor aggregation state throughout purification using dynamic light scattering or analytical size exclusion chromatography. If aggregation persists, consider native nanodiscs or amphipols as alternatives to conventional detergents for stabilizing the protein in solution .

How can contradictory results between in vitro and in vivo studies of qoxC function be reconciled?

Discrepancies between in vitro and in vivo studies of qoxC function may arise from several factors:

  • Physiological context differences:

    • Oxygen availability and redox state

    • Presence of cofactors and interaction partners

    • Growth phase-dependent regulation

  • Methodological limitations:

    • Detergent effects on protein conformation in vitro

    • Artificial substrates versus natural electron donors

    • Expression level differences between recombinant and native systems

To reconcile contradictory results:

  • Develop more physiologically relevant in vitro systems (proteoliposomes with native lipid composition)

  • Use genetically modified S. aureus strains with tagged qoxC to study the native protein

  • Employ advanced imaging techniques to visualize protein localization and interactions in live cells

When reporting contradictory findings, discuss possible explanations based on experimental conditions and propose follow-up experiments to resolve discrepancies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.