Recombinant Staphylococcus aureus Protein CrcB homolog 1 (crcB1)

What is the basic structure and function of Staphylococcus aureus CrcB1 protein?

Staphylococcus aureus CrcB1 (UniProt ID: Q6G8E8) is a 147-amino acid protein that functions as a putative fluoride ion transporter. The full amino acid sequence is: MHRQFLSSRCQNLFFKFKLLLFEVNQMQYVYIFIGGALGALLRYLISFLNTDGGFPIGTLIANLTGAFVMGLLTALTIAFFSNHPTLKKAITTGFLGALTTFSTFQLELIHMFDHQQFITLLLYAVTSYVFGILLCYVGIKLGGGLS . The protein is encoded by the crcB1 gene (Gene ID: USA300HOU_RS09465) located at positions 1,909,752–1,910,117 on the S. aureus USA300 genome . Functionally, CrcB1 appears to be involved in fluoride ion transport, specifically in facilitating fluoride efflux from bacterial cells, which helps maintain intracellular fluoride levels below inhibitory concentrations, thereby contributing to fluoride resistance .

How does crcB1 relate to bacterial fluoride resistance mechanisms?

The crcB1 gene in S. aureus plays a crucial role in bacterial fluoride resistance by encoding a protein that facilitates fluoride efflux. Research has demonstrated that overexpression of crcB1 (together with the adjacent crcB2 gene) significantly increases S. aureus tolerance to sodium fluoride (NaF), indicating its direct involvement in fluoride detoxification mechanisms . This resistance mechanism is physiologically important as fluoride is toxic to bacteria at certain concentrations, interfering with various enzymatic processes. By maintaining lower intracellular fluoride concentrations through active efflux, CrcB1 helps protect bacterial cells from fluoride toxicity. Experimental evidence shows that strains overexpressing crcB1&2 exhibit significantly higher growth (measured by OD600 values) at 16 mM and 64 mM NaF compared to wild-type strains, quantitatively demonstrating the protein's role in fluoride resistance .

What is the genomic context of crcB1 in Staphylococcus aureus?

In Staphylococcus aureus USA300, crcB1 is located at positions 1,909,752–1,910,117 on the genome. Notably, it is positioned adjacent to another gene (USA300HOU_RS09470, referred to as crcB2) located at positions 1,910,114–1,910,467 . These two genes overlap by four nucleotide bases, which strongly suggests they may be functionally related or co-regulated. This genomic arrangement, with the four-base overlap, indicates a potential cooperative role between these genes in facilitating fluoride efflux. Such gene arrangements are often indicative of operonic structures in bacteria, which allow for coordinated expression of functionally related proteins. The proximity and overlap of these genes suggest they may be transcribed as a single mRNA and function together in the fluoride resistance pathway of S. aureus .

What expression systems are most effective for producing recombinant S. aureus CrcB1 protein?

For recombinant expression of S. aureus CrcB1, Escherichia coli has proven to be an effective heterologous expression system. Successful expression has been achieved by fusing the full-length CrcB1 protein (amino acids 1-147) to an N-terminal His tag, which facilitates subsequent purification . When designing expression constructs, researchers should consider codon optimization for E. coli to improve expression efficiency, as S. aureus has a different codon usage bias. Additionally, for membrane proteins like CrcB1, expression conditions need to be carefully optimized to prevent protein aggregation or misfolding. This typically involves testing different E. coli strains (such as BL21(DE3), C41(DE3), or C43(DE3) which are designed for membrane protein expression), varying induction temperatures (typically 16-30°C), and adjusting inducer concentrations to find optimal expression conditions that balance yield and proper folding.

What are the recommended purification protocols for recombinant CrcB1 protein?

Purification of His-tagged recombinant CrcB1 protein typically employs immobilized metal affinity chromatography (IMAC) using nickel or cobalt resins. After cell lysis (which may require detergents for membrane protein extraction), the clarified lysate is applied to the IMAC column, followed by washing steps with increasing imidazole concentrations to remove non-specifically bound proteins. Pure CrcB1 is then eluted with high imidazole concentrations (typically 250-500 mM). For higher purity, size exclusion chromatography can be performed as a second purification step. The purified protein should achieve >90% purity as determined by SDS-PAGE . After purification, the protein can be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0, and the addition of 5-50% glycerol (with 50% being a common final concentration) is recommended for long-term storage at -20°C/-80°C to prevent freeze-thaw damage . It's advisable to aliquot the purified protein to avoid repeated freeze-thaw cycles, as these can lead to protein denaturation and loss of activity.

How can researchers verify the functional integrity of recombinant CrcB1 after purification?

Verifying the functional integrity of purified recombinant CrcB1 requires assessing its fluoride transport activity. This can be accomplished through several complementary approaches:

• Fluoride ion transport assays: Reconstituting purified CrcB1 into liposomes loaded with a fluoride-sensitive fluorescent dye (such as SBFI) to measure fluoride influx or efflux rates.

• Complementation assays: Testing whether the recombinant CrcB1 can restore fluoride resistance in a crcB knockout bacterial strain. Growth curves in the presence of varying fluoride concentrations can quantitatively assess functional restoration.

• Binding assays: Using isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to measure direct binding of fluoride ions to the purified protein.

• Structural integrity assessment: Circular dichroism (CD) spectroscopy to confirm proper secondary structure formation, particularly important for membrane proteins.

• In vivo functional verification: Similar to experiments described in the literature, where overexpression of crcB1 in S. aureus resulted in increased fluoride tolerance, demonstrating growth at higher NaF concentrations (16 mM and 64 mM) compared to control strains .

What experimental approaches can be used to measure CrcB1-mediated fluoride transport?

Several experimental approaches can be employed to measure CrcB1-mediated fluoride transport:

• Ion chromatography analysis: This technique provides direct measurement of intracellular fluoride concentrations. In published research, this method was used to demonstrate that bacterial strains with functional fluoride transporters maintained lower intracellular fluoride levels compared to strains with impaired transport mechanisms .

• Growth inhibition assays: By exposing S. aureus strains (wild-type, crcB1 knockout, and crcB1-overexpressing) to increasing concentrations of NaF and monitoring growth (OD600), researchers can indirectly assess CrcB1's fluoride transport activity. Strains overexpressing crcB1&2 exhibited significantly higher OD600 values at 16 mM and 64 mM NaF, indicating increased fluoride tolerance through enhanced efflux .

• Fluoride-selective electrode measurements: For real-time monitoring of fluoride transport in cell suspensions or reconstituted proteoliposomes.

• Fluorescent probes: Using fluoride-sensitive fluorescent dyes to visualize and quantify fluoride transport across membranes in real-time.

• Radioactive fluoride (18F) uptake/efflux assays: For highly sensitive detection of fluoride movement across membranes in various experimental systems.

Each of these methods offers different advantages in terms of sensitivity, temporal resolution, and applicability to different experimental systems (in vitro reconstituted systems versus whole cells).

How can researchers investigate the interaction between CrcB1 and potential inhibitors like BPU?

To investigate interactions between CrcB1 and potential inhibitors such as BPU (benzylphenyl urea), researchers can employ several methodological approaches:

• Checkerboard assays: This method allows for the systematic evaluation of synergistic interactions between compounds. For example, research has demonstrated synergistic antibacterial activity between BPU and fluoride against S. aureus, suggesting BPU may interact with fluoride transport mechanisms .

• Growth curve analysis: Comparing growth curves of wild-type, crcB1-knockout, and crcB1-overexpressing strains in the presence of various concentrations of the potential inhibitor. In published research, S. aureus strains overexpressing crcB1&2 required higher concentrations of BPU to achieve similar growth inhibition when combined with 8 mM NaF, suggesting CrcB1's involvement in the mechanism of action .

• Direct binding assays: Techniques such as isothermal titration calorimetry (ITC), surface plasmon resonance (SPR), or microscale thermophoresis (MST) can be used to measure binding affinities between purified CrcB1 and potential inhibitors.

• Fluoride transport assays: Measuring changes in fluoride transport activity when potential inhibitors are present, using the methods described in section 3.1.

• Structural studies: X-ray crystallography or cryo-EM of CrcB1 in complex with inhibitors can provide atomic-level insights into binding modes and mechanisms of inhibition.

• Mutagenesis studies: Systematic mutation of potential binding site residues to identify critical amino acids involved in inhibitor interactions.

What are the appropriate controls when studying CrcB1 function in fluoride resistance?

When studying CrcB1 function in fluoride resistance, several critical controls should be incorporated:

• Strain controls:

  • Wild-type S. aureus (baseline fluoride sensitivity)

  • crcB1 knockout strain (increased fluoride sensitivity)

  • crcB1-complemented strain (restored fluoride resistance)

  • Empty vector control strain (to account for vector effects)

  • crcB1-overexpressing strain (enhanced fluoride resistance)

• Treatment controls:

  • No fluoride treatment (baseline growth)

  • Range of fluoride concentrations (dose-response relationship)

  • Other ion treatments (specificity control)

• Assay controls:

  • For ion chromatography: standard curves with known fluoride concentrations

  • For growth assays: growth curves in standard media without stress agents

  • For gene expression studies: housekeeping genes as normalization controls

In published research, appropriate controls included wild-type S. aureus USA300, strains carrying empty pCM29 vector, and strains carrying the pCM29-crcB1&2 plasmid, which were tested under different concentrations of NaF, BPU, and combination treatments . These controls allowed researchers to conclusively demonstrate that crcB1&2 overexpression specifically increased fluoride tolerance.

How does the genomic relationship between crcB1 and crcB2 affect experimental design when studying CrcB1 function?

The genomic arrangement of crcB1 and crcB2, with their four-base overlap, presents important considerations for experimental design. This overlapping configuration suggests potential co-regulation or functional cooperation between these genes, which must be accounted for in experimental approaches:

• Gene manipulation strategies: When designing knockout or overexpression studies, researchers should consider the potential polar effects that manipulating one gene might have on the other. The four-base overlap means that disruption of crcB1 could affect the expression of crcB2 through altered transcriptional or translational coupling.

• Expression studies: Analysis of the transcriptional unit is essential to determine whether these genes are expressed as part of a single operon or independently. RT-PCR spanning the junction between the genes can determine if they are co-transcribed.

• Functional complementation: In published research, both genes (crcB1 and crcB2) were cloned together into the pCM29 plasmid for overexpression studies, recognizing their potential functional interdependence . This approach demonstrated increased fluoride tolerance, but to dissect individual contributions, researchers should design experiments that express each gene separately and together.

• Protein-protein interaction studies: The overlapping genomic arrangement raises the possibility that CrcB1 and CrcB2 proteins may physically interact to form a functional complex. Co-immunoprecipitation, bacterial two-hybrid, or FRET assays could be employed to investigate such interactions.

• Evolutionary analysis: Comparative genomics across different Staphylococcus species can reveal whether this arrangement is conserved, providing insights into evolutionary significance and functional importance.

What is known about the structure-function relationship of CrcB1 in comparison to other fluoride channels?

While detailed structural information specifically for S. aureus CrcB1 is limited, inferences can be made based on characterized CrcB homologs from other organisms:

• Structural predictions: Based on its amino acid sequence, S. aureus CrcB1 is predicted to be a membrane protein with multiple transmembrane domains, consistent with its role in ion transport. The amino acid sequence (MHRQFLSSRCQNLFFKFKLLLFEVNQMQYVYIFIGGALGALLRYLISFLNTDGGFPIGTLIANLTGAFVMGLLTALTIAFFSNHPTLKKAITTGFLGALTTFSTFQLELIHMFDHQQFITLLLYAVTSYVFGILLCYVGIKLGGGLS) suggests a hydrophobic protein with several membrane-spanning regions .

• Functional conservation: CrcB proteins are widely conserved across bacterial species, suggesting conserved structural features essential for fluoride transport. In various bacteria, the crcB gene facilitates fluoride efflux by maintaining intracellular fluoride levels below inhibitory concentrations .

• Oligomerization: Many ion channels function as oligomers. Research could investigate whether CrcB1 forms homodimers/homomultimers or heterodimers/heteromultimers with CrcB2, potentially explaining their genomic proximity.

• Key functional residues: Structure-function studies using site-directed mutagenesis could identify critical residues involved in fluoride selectivity and transport, comparing these to known functionally important residues in characterized fluoride channels.

• Comparative analysis: Homology modeling based on structurally characterized fluoride channels from other organisms could provide insights into S. aureus CrcB1's structure-function relationships.

How might CrcB1 function interact with other S. aureus stress response systems?

The function of CrcB1 in fluoride resistance likely intersects with other stress response systems in S. aureus, creating a complex regulatory network that researchers should consider:

• Metal homeostasis systems: Fluoride can form complexes with metal ions, potentially affecting metal-dependent enzymes and processes. Research should investigate potential crosstalk between CrcB1 function and metal homeostasis systems.

• General stress response pathways: Fluoride stress may activate general stress response mechanisms in S. aureus. Experiments could examine whether standard stress response regulators (e.g., σB) influence crcB1 expression or whether fluoride stress via crcB1 activates other stress pathways.

• Cell envelope stress responses: As a membrane protein involved in ion transport, CrcB1 function may be linked to cell envelope stress response systems. Research could investigate whether envelope stress inducers affect crcB1 expression or function.

• Antibiotic resistance mechanisms: The study showing synergistic effects between BPU and fluoride suggests potential links between CrcB1 function and antibiotic susceptibility . Further research could explore whether CrcB1 influences the efficacy of various antimicrobials against S. aureus.

• Biofilm formation: Ion homeostasis often influences biofilm formation in bacteria. Researchers could investigate whether CrcB1-mediated fluoride resistance affects S. aureus biofilm development or persistence.

What are common challenges in expressing recombinant CrcB1 and how can they be addressed?

Expression of membrane proteins like CrcB1 presents several challenges that researchers should anticipate and address:

• Protein toxicity: Overexpression of membrane proteins can be toxic to host cells. Solutions include:

  • Using tightly regulated expression systems (e.g., pET with T7 lysozyme co-expression)

  • Lowering induction temperature (16-20°C)

  • Reducing inducer concentration

  • Using specialized E. coli strains (C41, C43) designed for toxic protein expression

• Protein misfolding and aggregation: Membrane proteins often aggregate in inclusion bodies. Strategies to improve folding include:

  • Fusion with solubility-enhancing tags (MBP, SUMO)

  • Co-expression with chaperones

  • Addition of mild detergents to growth media

  • Using osmolytes like glycerol or sorbitol in growth media

• Low yield: Membrane proteins typically express at lower levels than soluble proteins. Approaches to improve yield:

  • Codon optimization for the expression host

  • Scale-up of culture volume

  • High cell-density fermentation

  • Testing multiple expression strains and conditions

• Protein instability: CrcB1 may be unstable after purification. Stabilization strategies include:

  • Adding glycerol (5-50%) to storage buffer

  • Including trehalose (6%) in buffer formulations

  • Maintaining appropriate pH (e.g., pH 8.0 for His-tagged CrcB1)

  • Aliquoting to avoid freeze-thaw cycles

• Extraction and solubilization issues: Membrane proteins require detergents for extraction. Optimization involves:

  • Screening multiple detergent types (mild vs. harsh)

  • Testing detergent concentrations

  • Evaluating different extraction conditions (time, temperature)

What quality control methods should be employed to ensure the integrity of recombinant CrcB1 preparations?

Ensuring the quality of recombinant CrcB1 preparations requires multiple complementary methods:

• Purity assessment:

  • SDS-PAGE with Coomassie or silver staining (target >90% purity)

  • Western blotting using anti-His antibodies for detection of full-length protein

  • Mass spectrometry for accurate mass determination and detection of degradation products

• Structural integrity:

  • Circular dichroism (CD) spectroscopy to confirm secondary structure content

  • Thermal shift assays to assess protein stability

  • Dynamic light scattering (DLS) to detect aggregation

  • Size exclusion chromatography to confirm monodispersity

• Functional verification:

  • Fluoride binding assays

  • Reconstitution into liposomes followed by transport assays

  • Complementation of fluoride-sensitive bacterial strains

• Batch consistency:

  • Lot-to-lot comparison using standardized assays

  • Consistent yield metrics across preparations

  • Storage stability testing at different temperatures and time points

• Contaminant testing:

  • Endotoxin testing for preparations intended for immunological studies

  • Nucleic acid contamination assessment (A260/A280 ratio)

  • Residual detergent quantification

How can researchers address experimental variability when measuring CrcB1-mediated fluoride resistance?

Experimental variability in CrcB1-mediated fluoride resistance assays can arise from multiple sources. Here are strategies to address and minimize this variability:

• Standardize growth conditions:

  • Use consistent media preparation methods

  • Maintain precise temperature control during growth

  • Standardize inoculum preparation (pre-culture conditions, growth phase, and cell density)

  • Ensure consistent aeration/agitation during growth experiments

• Control for genetic stability:

  • Regularly sequence plasmids to confirm insert integrity

  • Minimize passage number of recombinant strains

  • Use freshly transformed cells for critical experiments

  • Include appropriate controls in each experiment (wild-type, empty vector, etc.)

• Optimize measurement techniques:

  • For growth assays: use automated plate readers with temperature control

  • For ion chromatography: include internal standards and generate standard curves with each experiment

  • For gene expression analysis: validate reference genes under experimental conditions

• Statistical approaches:

  • Perform biological replicates (independent cultures) and technical replicates

  • Apply appropriate statistical tests based on data distribution

  • Report variability (standard deviation, standard error, confidence intervals)

  • Use power analysis to determine appropriate sample sizes

• Data normalization:

  • When comparing across experiments, normalize to internal controls

  • For growth assays, consider area under the curve or doubling time rather than single timepoint OD measurements

  • For fluoride measurements, normalize to total protein or cell number

In published research, consistent methodologies allowed researchers to reliably demonstrate that strains overexpressing crcB1&2 exhibited significantly higher OD600 values at 16 mM and 64 mM NaF compared to control strains .

How should researchers interpret changes in fluoride sensitivity when manipulating crcB1 expression?

Interpreting changes in fluoride sensitivity requires careful consideration of multiple parameters and potential confounding factors:

• Growth curve analysis:

  • Compare complete growth curves rather than single-point measurements

  • Calculate key parameters: lag phase duration, maximum growth rate, final cell density

  • Consider that apparent "resistance" may reflect different growth aspects (e.g., extended lag phase vs. reduced growth rate)

• Dose-response relationships:

  • Determine MIC (minimum inhibitory concentration) values

  • Calculate IC50 values (concentration causing 50% growth inhibition)

  • Assess whether crcB1 manipulation shifts the entire dose-response curve or changes its shape

• Distinguishing direct from indirect effects:

  • Measure intracellular fluoride concentrations directly using ion chromatography

  • Assess whether changes in fluoride sensitivity correlate with changes in intracellular fluoride levels

  • Consider whether crcB1 manipulation affects other physiological processes that might indirectly influence fluoride sensitivity

• Quantifying relative contributions:

  • When studying crcB1 and crcB2 together, design experiments that can distinguish their individual contributions

  • Use partial deletion or selective mutation approaches to assess the impact of specific protein domains or residues

• Contextualizing within the broader stress response:

  • Determine whether altered fluoride sensitivity reflects a specific effect on fluoride transport or a general stress response

  • Assess cross-sensitivity to other stressors to evaluate specificity

Published research demonstrated that overexpression of crcB1&2 in S. aureus resulted in significantly higher OD600 values at 16 mM and 64 mM NaF, providing quantitative evidence of increased fluoride tolerance .

What analytical approaches can be used to study the interaction between BPU, fluoride, and CrcB1?

The interaction between BPU, fluoride, and CrcB1 represents a complex system requiring sophisticated analytical approaches:

• Checkerboard assays and synergy analysis:

  • Generate mathematical models of interaction (e.g., fractional inhibitory concentration index)

  • Distinguish between additive, synergistic, or antagonistic effects

  • Compare interaction patterns in wild-type vs. crcB1-manipulated strains

• Mechanistic investigation:

  • Determine whether BPU directly inhibits CrcB1 function or acts through other mechanisms

  • Measure intracellular fluoride accumulation in the presence of BPU to assess its impact on fluoride transport

  • Investigate whether BPU affects crcB1 expression at the transcriptional or translational level

• Structure-activity relationship studies:

  • Test structural analogs of BPU to identify critical chemical features for activity

  • Correlate chemical modifications with changes in synergy with fluoride

  • Use molecular docking if structural information becomes available

• Resistance development analysis:

  • Select for resistance to BPU-fluoride combination treatment

  • Sequence crcB1 and related genes in resistant mutants

  • Perform whole-genome sequencing to identify other potential resistance mechanisms

• Transcriptomic and proteomic approaches:

  • Compare gene/protein expression profiles in response to fluoride alone, BPU alone, and combination treatment

  • Identify pathways differentially affected by combination treatment

  • Correlate changes in crcB1/2 expression with other cellular responses

Published research has shown that the antibacterial effect of BPU remained consistent across strains regardless of crcB overexpression, while combination treatment of BPU with 8 mM NaF required higher BPU concentrations to achieve similar inhibition in strains overexpressing crcB1&2 compared to control strains .

How can researchers integrate findings about CrcB1 function with broader understanding of S. aureus pathogenicity?

Integrating CrcB1 function into the broader context of S. aureus pathogenicity requires multidisciplinary approaches:

• Environmental relevance assessment:

  • Determine fluoride concentrations in relevant host environments (oral cavity, skin, medical devices)

  • Assess crcB1 expression during infection or colonization of different sites

  • Investigate whether fluoride stress influences virulence factor expression

• Host-pathogen interaction studies:

  • Examine whether fluoride exposure or crcB1 expression affects interactions with host cells

  • Assess impact on immune recognition and evasion mechanisms

  • Investigate potential role in biofilm formation on tissues or medical devices

• Comparative analysis across clinical isolates:

  • Sequence crcB1/2 in clinical S. aureus isolates from different infection sites

  • Correlate sequence variations with fluoride resistance phenotypes

  • Assess whether certain variants are associated with specific clinical presentations

• Therapeutic potential evaluation:

  • Investigate crcB1 as a potential drug target

  • Assess whether fluoride-enhancing compounds like BPU affect virulence in infection models

  • Determine whether fluoride resistance mechanisms influence efficacy of other antimicrobials

• Evolutionary considerations:

  • Examine crcB1 conservation across S. aureus lineages

  • Compare with other Staphylococcal species to understand evolutionary pressures

  • Assess horizontal gene transfer patterns for fluoride resistance determinants

This integration provides context for understanding whether CrcB1 function represents a specialized adaptation to specific environments or a general stress response mechanism with broader implications for S. aureus pathogenicity and persistence.