Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Description

Role in Fluoride Resistance

CrcB2 operates synergistically with the adjacent crcB1 gene to mediate fluoride efflux:

ParameterWild-Type StraincrcB1&2 Overexpression Strain
NaF Tolerance (16 mM)OD₆₀₀ = 0.4OD₆₀₀ = 0.8
Intracellular Fluoride (μM)12.5 ± 1.25.8 ± 0.9
BPU Synergy (0.625 μM + NaF)90% Growth Inhibition40% Growth Inhibition

Data derived from growth curves and ion chromatography .

Overexpression of crcB1&2 significantly increases fluoride tolerance, reducing intracellular fluoride accumulation by ~54% compared to wild-type strains . This mechanism is critical for S. aureus survival in environments with fluoride-based antimicrobials.

Key Studies

  • Synergy with BPU: The benzophenone urea (BPU) compound enhances fluoride’s antibacterial activity by disrupting CrcB-mediated efflux. Combined treatment (8 mM NaF + 0.625 μM BPU) achieves >90% growth inhibition in wild-type strains but only 40% in crcB1&2-overexpressing mutants .

  • Gene Knockout Effects: Deletion of crcB2 reduces fluoride resistance by 3–4 logs, confirming its role in bacterial persistence .

Transcriptional Regulation

  • Co-localized with crcB1 on a 4-bp overlapping operon, suggesting cooperative regulation .

  • Expression is upregulated under fluoride stress, but regulatory pathways remain uncharacterized .

Applications in Antimicrobial Development

CrcB2 is a target for enhancing fluoride-based therapies:

  • BPU-Fluoride Combinations: Reduce effective fluoride concentrations required for S. aureus inhibition by 8-fold .

  • Vaccine Potential: Recombinant CrcB2 is marketed as a vaccine component due to its surface localization and conservation across S. aureus strains .

Ongoing Research Challenges

  • Mechanistic Gaps: The exact structural basis for fluoride transport and interaction with BPU is unresolved .

  • Clinical Relevance: No direct evidence yet links CrcB2 to human infection outcomes, though fluoride resistance may favor oral or topical colonization .

Table 1: Growth Inhibition Under Fluoride Stress

StrainNaF (16 mM)NaF (64 mM)NaF + BPU (8 mM + 0.625 μM)
Wild-Type40%85%90%
crcB1&2-Overexpression20%50%40%

Table 2: Intracellular Fluoride Levels

ConditionFluoride Concentration (μM)
Wild-Type + NaF12.5 ± 1.2
crcB1&2-Overexpression5.8 ± 0.9

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB2; SAOUHSC_01904; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Staphylococcus aureus (strain NCTC 8325)
Target Names
crcB2
Target Protein Sequence
MISIILVMIGGGFGAIARSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLTIGLSISISW FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI
Uniprot No.

Target Background

Function
Crucial for reducing fluoride concentration in the cell, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CrcB homolog 2 (crcB2) and what is its primary function in Staphylococcus aureus?

CrcB homolog 2 (crcB2) is a membrane protein in Staphylococcus aureus that functions primarily as an anion channel responsible for fluoride ion (F⁻) efflux. It plays a crucial role in bacterial fluoride resistance mechanisms. The protein is encoded by the crcB2 gene, which typically exists in tandem with crcB1 in many bacterial species. In S. aureus, as in other bacteria, CrcB2 helps protect the organism from the toxic effects of environmental fluoride by facilitating its export from the cell .

How does CrcB2 differ structurally from CrcB1 in bacterial species?

CrcB2 in bacterial species typically consists of approximately 116 amino acids, while CrcB1 is often slightly larger at around 124 amino acids. Sequence analysis reveals approximately 58.4% amino acid sequence similarity between CrcB1 and CrcB2 proteins. When compared to the well-characterized Escherichia coli CrcB (127 amino acids), S. aureus CrcB2 shows approximately 62.2% sequence similarity, while CrcB1 shows about 51% similarity to the E. coli homolog . These structural differences may contribute to their specific functions within the bacterial cell membrane.

What is the genetic organization of crcB genes in Staphylococcus and related bacteria?

In most bacterial species, including Staphylococcus, the crcB1 and crcB2 genes exist in tandem and are oriented in the same direction on the bacterial chromosome. This tandem arrangement suggests potential co-regulation of these genes and likely indicates their functional relationship in fluoride resistance. The genetic proximity also suggests they may have evolved from a gene duplication event, while maintaining distinct but complementary functions in bacterial fluoride homeostasis .

How do the fluoride resistance mechanisms differ between Staphylococcus aureus and other bacterial species?

Fluoride resistance mechanisms vary significantly across bacterial species. Based on comparative studies, bacteria can be categorized into at least three groups:

  • Group I (e.g., certain Streptococcus mutans strains): One of two eriC1 genes predominantly affects fluoride resistance.

  • Group II (e.g., Streptococcus anginosus): The eriC1 gene is responsible for fluoride resistance, while eriC2 does not contribute significantly.

  • Group III (e.g., Streptococcus sanguinis): Both crcB1 and crcB2 are crucial for fluoride resistance, while eriC2 plays no significant role.

What are the implications of cross-species complementation studies for understanding CrcB2 function?

This indicates that:

  • While CrcB proteins can functionally substitute for EriC proteins in mutant strains, they employ distinct mechanisms

  • Co-existence of different F⁻ channels (EriC and CrcB) does not produce additive effects on fluoride resistance

  • The cellular context and potential regulatory factors influence the functional expression of these proteins

These findings have implications for understanding the evolutionary adaptability of fluoride resistance mechanisms across bacterial species and potential applications in developing antimicrobial strategies.

What molecular mechanisms regulate CrcB2 expression in response to environmental fluoride?

The regulation of CrcB2 expression in response to environmental fluoride involves complex molecular mechanisms that are still being fully elucidated. Current research suggests:

  • Riboswitch-mediated regulation: Many bacteria use fluoride-sensing riboswitches in the 5' untranslated regions of crcB mRNAs to regulate expression in response to fluoride levels

  • Potential coordination with stress response systems: Expression may be linked to broader stress response mechanisms in the bacterial cell

  • Possible post-translational regulation: Activity may be modulated through protein modifications or interactions with other membrane components

Understanding these regulatory mechanisms is critical for developing strategies to potentially modulate fluoride resistance in pathogenic bacteria like S. aureus .

What are the optimal conditions for expressing recombinant S. aureus CrcB2 in heterologous systems?

For optimal expression of recombinant S. aureus CrcB2 in heterologous systems, researchers should consider the following parameters:

Expression System Selection:

  • E. coli BL21(DE3) is generally suitable for initial expression attempts

  • For membrane proteins like CrcB2, C41(DE3) or C43(DE3) strains may yield better results

  • Yeast systems (P. pastoris or S. cerevisiae) can be considered for improved folding of membrane proteins

Expression Conditions:

  • Induction: IPTG concentrations of 0.1-0.5 mM typically yield better results than higher concentrations

  • Temperature: Lower temperatures (16-25°C) during induction generally improve proper folding

  • Media supplements: Addition of 1% glucose can reduce basal expression and improve yields

  • Duration: Extended expression times (16-24 hours) at lower temperatures often yield better results

Solubilization Guidelines:

  • For membrane extraction, mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations just above their critical micelle concentration

  • Addition of glycerol (10-15%) to buffers can improve protein stability

Purification Considerations:

  • Immobilized metal affinity chromatography (IMAC) with a histidine tag is generally effective

  • Size exclusion chromatography as a secondary purification step improves homogeneity

These conditions should be optimized for each specific experimental context and expression construct design .

What methods are most effective for assessing CrcB2 functionality in fluoride transport?

Several complementary methods can effectively assess CrcB2 functionality in fluoride transport:

Whole-Cell Based Assays:

  • Fluoride resistance growth assays:

    • Comparing growth curves of wild-type, CrcB2-knockout, and complemented strains in media containing various NaF concentrations (50-200 ppm)

    • Measuring minimum inhibitory concentrations (MICs) through serial dilution methods

  • Fluoride accumulation assays:

    • Using fluoride-specific electrodes to measure intracellular versus extracellular fluoride concentrations

    • Employing fluoride-sensitive fluorescent indicators for real-time monitoring

Reconstituted Systems:

  • Liposome-based transport assays:

    • Reconstituting purified CrcB2 into liposomes

    • Measuring fluoride influx/efflux using fluoride-sensitive dyes trapped in liposomes

    • Assessing ion selectivity through competition experiments

  • Planar lipid bilayer electrophysiology:

    • Recording single-channel currents to determine conductance properties

    • Characterizing gating kinetics and ion selectivity

Fluoride Binding Assays:

  • Isothermal titration calorimetry (ITC) to determine binding affinities

  • Fluorescence-based binding assays using protein intrinsic fluorescence

Table 1: Comparison of Methods for Assessing CrcB2 Functionality

MethodAdvantagesLimitationsKey Parameters
Growth AssaysSimple setup; physiologically relevantIndirect measure; influenced by multiple factorsNaF concentration range: 0-200 ppm; pH control critical
Fluoride ElectrodeDirect measurement; quantitativeLimited temporal resolutionCalibration critical; maintain consistent cell density
Liposome AssaysControlled environment; direct transport measurementComplex preparation; artificial systemLipid composition affects function; protein:lipid ratio critical
ElectrophysiologySingle-molecule resolution; detailed kineticsTechnically demanding; low throughputRequires stable reconstitution; sensitive to buffer conditions
Binding AssaysDirect interaction measurement; quantitativeDoes not necessarily demonstrate transportControl for non-specific binding; determine Kd values

These methods provide complementary data that collectively offer a comprehensive assessment of CrcB2 function in fluoride transport .

How can site-directed mutagenesis be effectively applied to study structure-function relationships in CrcB2?

Site-directed mutagenesis represents a powerful approach for elucidating structure-function relationships in CrcB2. Based on sequence conservation analyses and structural predictions, the following strategic approach is recommended:

Priority Targets for Mutagenesis:

  • Conserved residues between CrcB1 and CrcB2 (58.4% similarity) - likely critical for core functionality

  • Residues unique to CrcB2 versus CrcB1 - potentially responsible for functional differences

  • Residues conserved across bacterial species - likely essential for fluoride channel activity

  • Predicted transmembrane domain residues - critical for channel formation and ion selectivity

Recommended Mutagenesis Approach:

  • Alanine scanning of conserved residues within predicted transmembrane regions

  • Charge reversal mutations of basic/acidic residues in predicted pore regions

  • Conservative substitutions to probe specific physicochemical requirements

  • Domain swapping between CrcB1 and CrcB2 to identify functionally distinct regions

Functional Assessment After Mutagenesis:

  • Fluoride resistance assays in complemented bacterial strains

  • Protein expression and membrane localization analysis

  • In vitro fluoride transport assays using reconstituted proteins

  • Structural stability assessment using circular dichroism or thermal shift assays

Table 2: Critical Residues in CrcB2 for Targeted Mutagenesis

Residue PositionPredicted FunctionSuggested MutationsExpected Functional Impact
Conserved basic residuesFluoride coordinationR→A, R→E, K→A, K→EDisrupted fluoride binding
Conserved polar residuesChannel formationS→A, T→A, N→A, Q→AAltered channel properties
Conserved hydrophobic residuesMembrane integrationL→A, I→A, V→ACompromised structural integrity
Signature sequence residuesSelectivity filterConservative substitutionsAltered ion selectivity

By systematically combining mutagenesis with functional assays, researchers can develop a comprehensive model of how CrcB2 structure relates to its function in fluoride transport .

How should researchers interpret discrepancies between in vitro and in vivo fluoride resistance data for CrcB2?

When confronting discrepancies between in vitro and in vivo fluoride resistance data related to CrcB2, researchers should consider multiple factors that could explain these differences:

Physiological Factors:

  • Cellular context differences: In vivo systems contain numerous components that may interact with or regulate CrcB2 function that are absent in vitro

  • Compensatory mechanisms: Bacteria may upregulate alternative fluoride resistance systems in vivo when CrcB2 is compromised

  • Growth phase dependencies: CrcB2 activity may vary with bacterial growth phase in vivo

Methodological Considerations:

  • Expression levels: Protein expression levels often differ between in vitro and in vivo systems

  • Post-translational modifications: In vivo modifications may be missing in recombinant systems

  • Membrane environment: Lipid composition differences between natural membranes and in vitro systems

Analytical Framework:

  • Establish dose-response relationships across both systems to identify threshold effects

  • Perform complementation studies with varying expression levels

  • Examine time-dependent effects, as equilibrium assumptions may not hold in vivo

  • Analyze protein-protein interactions that may occur in vivo but not in vitro

Resolution Strategies:

  • Employ native membrane vesicles for in vitro studies to better approximate the in vivo environment

  • Use inducible expression systems to titrate CrcB2 levels and correlate with functional outcomes

  • Implement genetic approaches to identify potential interaction partners in vivo

  • Develop mathematical models that account for differences in experimental conditions

By systematically addressing these factors, researchers can develop a more complete understanding of how CrcB2 functions in both experimental contexts and reconcile apparent discrepancies in the data .

What bioinformatic approaches are most valuable for analyzing CrcB homologs across bacterial species?

Several bioinformatic approaches provide valuable insights when analyzing CrcB homologs across bacterial species:

Sequence-Based Analyses:

  • Multiple sequence alignment (MSA) using MUSCLE, MAFFT, or T-Coffee algorithms to identify conserved motifs

  • Construction of phylogenetic trees using maximum likelihood or Bayesian methods to understand evolutionary relationships

  • Conservation mapping to identify functionally critical residues

  • Coevolution analysis to identify potentially interacting residues

Structural Bioinformatics:

  • Homology modeling using available structures of related proteins

  • Molecular dynamics simulations to predict conformational changes

  • Electrostatic surface mapping to identify potential fluoride binding sites

  • Transmembrane topology prediction using programs like TMHMM or Phobius

Functional Prediction:

  • Gene neighborhood analysis to identify potentially co-regulated genes

  • Identification of regulatory elements (e.g., fluoride riboswitches) in promoter regions

  • Protein-protein interaction predictions

  • Gene expression correlation analysis across different conditions

Comparative Genomics:

  • Assessment of crcB gene distribution across bacterial taxa

  • Analysis of selective pressure (dN/dS ratios) to identify evolving regions

  • Identification of horizontal gene transfer events

  • Synteny analysis to examine conservation of genomic context

Table 3: Recommended Bioinformatic Tools for CrcB Analysis

Analysis TypeRecommended ToolsKey ParametersOutput Interpretation
Sequence AlignmentMUSCLE, MAFFTGap opening/extension penalties; substitution matricesConservation patterns; insertions/deletions
Phylogenetic AnalysisRAxML, MrBayes, IQ-TREESubstitution model; bootstrap replicatesEvolutionary relationships; divergence times
Structure PredictionAlphaFold2, SWISS-MODELTemplate selection; refinement parameters3D structural models; confidence scores
Transmembrane TopologyTMHMM, TOPCONSHydrophobicity scales; signal peptide predictionMembrane-spanning regions; orientation
Coevolution AnalysisEVcouplings, GREMLINAlignment depth; contact thresholdPredicted residue contacts; interaction networks
Genomic ContextMicrobesOnline, STRINGDistance threshold; pathway enrichmentGene neighborhoods; functional associations

These complementary approaches provide a comprehensive framework for understanding CrcB2's evolution, structure, and function across bacterial species .

What are the most promising approaches for targeting CrcB2 in antimicrobial development?

Several promising approaches exist for targeting CrcB2 in antimicrobial development:

Direct Inhibition Strategies:

  • Small molecule channel blockers: Developing compounds that specifically bind to and occlude the CrcB2 pore

  • Peptide inhibitors: Designing peptides that mimic natural interaction partners and disrupt channel function

  • Allosteric modulators: Identifying compounds that bind to non-pore regions and induce conformational changes that inhibit function

Combination Approaches:

  • Fluoride potentiation: Combining fluoride with CrcB2 inhibitors to enhance sensitivity

  • Multi-target strategies: Simultaneously targeting multiple fluoride resistance mechanisms (CrcB2 and EriC)

  • Stress response amplification: Combining CrcB2 inhibition with compounds that induce additional cellular stress

Novel Therapeutic Modalities:

  • Antisense oligonucleotides targeting crcB2 mRNA

  • CRISPR-based antimicrobials targeting the crcB2 gene

  • Anti-CrcB2 antibodies conjugated to antimicrobial agents

Rational Drug Design Considerations:

  • Focus on regions unique to bacterial CrcB2 to minimize off-target effects

  • Target conserved residues across pathogenic species for broad-spectrum activity

  • Consider species-specific variations in CrcB2 for narrow-spectrum applications

  • Exploit structural differences between CrcB1 and CrcB2 for selective targeting

The most promising approach may involve developing small molecule inhibitors that specifically block the fluoride transport function of CrcB2, potentially in combination with existing antimicrobials to enhance their efficacy against resistant strains .

What technological advances would most benefit CrcB2 structural and functional studies?

Several technological advances would significantly benefit structural and functional studies of CrcB2:

Structural Biology Advances:

  • Improved cryo-electron microscopy (cryo-EM) techniques for membrane protein structure determination at higher resolution

  • Advanced nuclear magnetic resonance (NMR) methods for dynamic structural analysis in native-like environments

  • Hybrid methods combining X-ray crystallography, cryo-EM, and computational prediction

  • Time-resolved structural techniques to capture conformational changes during transport

Functional Characterization Tools:

  • Enhanced fluoride-specific fluorescent probes with improved sensitivity and temporal resolution

  • Microfluidic systems for high-throughput functional screening of CrcB2 variants

  • Advanced single-molecule techniques for real-time monitoring of transport events

  • Improved reconstitution systems that better mimic native membrane environments

Computational Advances:

  • Enhanced molecular dynamics simulations capable of modeling ion permeation events

  • Artificial intelligence approaches for predicting protein-ligand interactions

  • Improved homology modeling algorithms for membrane proteins

  • Systems biology models incorporating CrcB2 function in cellular context

Genetic Technology Improvements:

  • CRISPR-based precise genome editing techniques for studying CrcB2 in native contexts

  • Inducible and tunable expression systems for controlled studies

  • Advanced reporter systems for real-time monitoring of expression and localization

  • Single-cell analysis methods to assess cell-to-cell variability in CrcB2 function

These technological advances would collectively enable more comprehensive understanding of CrcB2 structure, function, and potential as a therapeutic target .

How does understanding CrcB2 function contribute to broader knowledge of bacterial ion homeostasis?

Understanding CrcB2 function provides several important contributions to our broader knowledge of bacterial ion homeostasis:

  • Novel Ion Transport Mechanisms: CrcB2 represents a distinct class of fluoride-specific channels, expanding our understanding of ion selectivity mechanisms. Unlike many ion channels that discriminate based primarily on charge and size, CrcB proteins appear to have evolved highly specific mechanisms for recognizing and transporting fluoride ions.

  • Evolutionary Adaptations: The presence of CrcB homologs across diverse bacterial species highlights evolutionary adaptation to environmental fluoride exposure. The varying arrangements and functional relationships between CrcB1, CrcB2, and EriC channels across species demonstrate how bacteria have evolved different solutions to the same challenge.

  • Regulatory Integration: CrcB2 function provides insights into how bacteria integrate specific ion stresses with their broader stress response systems. The fluoride-responsive riboswitch mechanism controlling crcB expression represents a direct link between environmental sensing and transcriptional regulation.

  • Membrane Protein Cooperation: The functional relationship between CrcB1 and CrcB2 in species like S. sanguinis, where both are required for fluoride resistance, demonstrates how membrane proteins can work cooperatively to maintain ion homeostasis.

  • Stress Response Networks: Fluoride resistance through CrcB2 connects to broader bacterial stress response networks, helping us understand how bacteria prioritize and coordinate responses to multiple environmental challenges.

By continuing to investigate CrcB2 function across diverse bacterial species, researchers can develop more comprehensive models of how bacteria maintain ion homeostasis in challenging environments, with potential applications in both basic science and antimicrobial development .

What are the implications of CrcB2 research for developing new approaches to combat antimicrobial resistance?

Research on CrcB2 has several significant implications for developing novel approaches to combat antimicrobial resistance:

  • Novel Target Identification: CrcB2 represents a relatively unexplored target for antimicrobial development. As a membrane protein essential for fluoride resistance in many pathogenic bacteria including S. aureus, selective inhibition could potentially disrupt bacterial survival in environments containing fluoride.

  • Sensitization Strategies: Inhibiting CrcB2 could potentially sensitize bacteria to fluoride-containing compounds or environments, creating new combination treatment possibilities. This "sensitizer" approach differs from direct antimicrobial action and may face different resistance mechanisms.

  • Species-Specific Targeting: The variations in fluoride resistance mechanisms across bacterial species (CrcB vs. EriC) provide opportunities for developing narrow-spectrum antimicrobials that target specific pathogens while sparing beneficial microbiota.

  • Resistance Mechanism Insights: Studying how bacteria protect themselves from toxic ions through CrcB2 provides broader insights into membrane-based defense mechanisms that may be relevant to understanding antimicrobial resistance.

  • Biofilm Disruption Potential: As fluoride resistance may be particularly important in biofilm environments (such as dental plaque), targeting CrcB2 could potentially disrupt biofilm formation or maintenance in certain bacterial communities.

  • Combination Therapy Design: Understanding the relationship between different fluoride resistance mechanisms (CrcB1, CrcB2, EriC) across species provides a foundation for rational design of combination therapies targeting multiple mechanisms simultaneously.

By leveraging our understanding of CrcB2 structure, function, and regulation, researchers can explore these diverse approaches to address the growing challenge of antimicrobial resistance in pathogenic bacteria such as S. aureus .

What specialized reagents and genetic constructs are most valuable for CrcB2 research?

For comprehensive CrcB2 research, the following specialized reagents and genetic constructs are particularly valuable:

Expression Constructs:

  • Codon-optimized crcB2 genes from S. aureus in various expression vectors (pET, pBAD, pMAL) with different fusion tags (His, GST, MBP) for bacterial expression

  • Mammalian expression vectors containing crcB2 for heterologous expression studies

  • Temperature-sensitive and inducible expression systems for controlled expression

  • Fluorescent protein fusions (GFP, mCherry) for localization studies

Mutant Libraries:

  • Alanine-scanning mutant collection targeting conserved residues

  • Site-directed mutants of predicted channel-forming residues

  • CrcB1/CrcB2 chimeric constructs for domain function analysis

  • Truncation mutants to define minimal functional domains

Purification Resources:

  • Optimized detergent screening kits for membrane protein extraction

  • Specialized resins for membrane protein purification

  • Nanodiscs and liposome reconstitution kits

  • Isotopically labeled media for NMR studies

Assay Tools:

  • Fluoride-specific fluorescent probes for transport assays

  • Fluoride ion-selective electrodes calibrated for biological samples

  • Bacterial strains with crcB1/crcB2 knockouts for complementation studies

  • Fluoride riboswitch reporter constructs for expression studies

Table 4: Essential Reagents for CrcB2 Research

Reagent CategorySpecific ExamplesApplicationsSpecial Considerations
Expression VectorspET28a-His-CrcB2, pBAD-CrcB2-GFPRecombinant protein production, localization studiesCodon optimization critical; consider fusion tag position
Bacterial StrainsBL21(DE3), C41(DE3), S. aureus crcB2 knockoutExpression, complementation studiesGrowth conditions affect expression quality
DetergentsDDM, LMNG, OGMembrane protein extractionDetergent:protein ratio critical; test multiple options
Fluoride SourcesNaF, KF solutionsResistance assays, transport studiespH control essential; use non-glass containers
Reconstitution MaterialsE. coli lipids, POPC/POPE mixturesFunctional assaysLipid composition affects function
AntibodiesAnti-His, anti-CrcB2 custom antibodiesDetection, localizationValidate specificity across species

These specialized resources enable comprehensive investigation of CrcB2 structure, function, and potential as a therapeutic target .

What are the best experimental model systems for studying CrcB2 in the context of bacterial pathogenesis?

Several experimental model systems are particularly valuable for studying CrcB2 in the context of bacterial pathogenesis:

In Vitro Systems:

  • Isogenic Mutant Comparisons: Wild-type S. aureus strains alongside crcB2 knockout and complemented strains for direct comparison of virulence phenotypes

  • Controlled Expression Systems: Strains with inducible crcB2 expression to study dose-dependent effects

  • Reporter Fusion Systems: Transcriptional and translational fusions to monitor crcB2 expression during infection processes

  • Co-culture Models: Bacterial-host cell co-culture systems to assess CrcB2's role in adherence, invasion, and intracellular survival

Infection Models:

  • Tissue Culture Systems:

    • Human keratinocyte infection models for skin infection dynamics

    • Macrophage infection models to assess intracellular survival

    • Osteoblast models for bone infection studies

    • Endothelial cell models for bloodstream infection dynamics

  • Ex Vivo Models:

    • Human skin explant models

    • Whole blood survival assays

    • Organ perfusion models

  • In Vivo Models:

    • Murine systemic infection models

    • Skin and soft tissue infection models

    • Implant-associated infection models

    • Endocarditis models

Environmental Stress Models:

  • Biofilm formation assays with varying fluoride concentrations

  • Antimicrobial tolerance testing in fluoride-containing environments

  • Mixed-species biofilm models to assess competitive fitness

Table 5: Comparison of Model Systems for CrcB2 Pathogenesis Studies

Model SystemAdvantagesLimitationsKey Applications
Isogenic Mutant ComparisonDirect assessment of CrcB2 contributionMay have compensatory mutationsBaseline phenotypic characterization
Inducible ExpressionControlled CrcB2 levelsArtificial expression timingDose-response relationships
Tissue CultureWell-controlled environment; human cellsLacks complex host responseInitial host-pathogen interactions
Murine ModelsComplex host response; organ-specific effectsSpecies differences from humanIn vivo relevance; systemic effects
Biofilm ModelsMimics natural growth stateVariable reproducibilityPersistence mechanisms; antimicrobial tolerance

The optimal approach combines multiple model systems to comprehensively assess CrcB2's role in S. aureus pathogenesis across different infection contexts and environmental conditions .

What are the key unresolved questions in our understanding of CrcB2 function and regulation?

Despite significant advances in understanding CrcB2, several critical questions remain unresolved:

  • Structural Determinants of Function:

    • What is the precise three-dimensional structure of S. aureus CrcB2?

    • How does the protein architecture create fluoride specificity?

    • What conformational changes occur during ion transport?

    • How do CrcB2 monomers assemble to form functional channels?

  • Functional Mechanisms:

    • What is the exact stoichiometry of fluoride transport?

    • Is transport passive or coupled to other ion movements?

    • How does CrcB2 achieve selectivity for fluoride over other halides?

    • What is the transport kinetics and capacity of CrcB2 channels?

  • Regulatory Networks:

    • How is crcB2 expression regulated beyond fluoride riboswitches?

    • Are there post-translational modifications that modulate CrcB2 function?

    • How does CrcB2 activity integrate with broader stress response networks?

    • Is there cross-talk between CrcB2 and other ion homeostasis systems?

  • Species-Specific Variations:

    • Why do some species rely on CrcB while others use EriC channels?

    • What factors determine the relative contributions of CrcB1 versus CrcB2?

    • How has evolutionary pressure shaped CrcB2 sequence and function?

    • Do pathogenic strains have distinct CrcB2 functional characteristics?

  • Pathogenesis Relevance:

    • Does CrcB2 contribute to virulence in fluoride-rich infection sites?

    • Does CrcB2 function affect biofilm formation or antimicrobial tolerance?

    • Could CrcB2 inhibition sensitize bacteria to host defense mechanisms?

    • Is CrcB2 expressed differently in commensal versus pathogenic contexts?

Addressing these questions will require integrated approaches combining structural biology, molecular genetics, biochemistry, and infection biology. The answers will not only advance our fundamental understanding of bacterial ion homeostasis but may also reveal new therapeutic opportunities .

How might research on CrcB2 evolve over the next decade, and what potential applications could emerge?

Research on CrcB2 is likely to evolve significantly over the next decade, with several promising directions and potential applications:

Scientific Advancements:

  • Structural Biology Revolution: High-resolution structures of CrcB2 will likely emerge through advances in cryo-EM and computational prediction, revealing the molecular basis for fluoride selectivity and transport.

  • Systems Biology Integration: CrcB2 function will be increasingly understood within the context of bacterial stress response networks and ion homeostasis systems.

  • Evolutionary Insights: Comparative genomics across diverse bacterial species will reveal how fluoride resistance mechanisms have evolved and adapted to different ecological niches.

  • Functional Diversity: Greater understanding of the functional differences between CrcB homologs and paralogs will emerge, potentially revealing specialized roles beyond fluoride transport.

Methodological Innovations:

  • Single-Molecule Approaches: Advanced techniques will enable real-time visualization of CrcB2 function at the single-molecule level.

  • In Situ Structural Studies: Methods to study membrane protein structure within native cellular environments will provide more physiologically relevant insights.

  • High-Throughput Functional Assays: Development of scalable assays will accelerate the screening of CrcB2 modulators and functional variants.

Potential Applications:

  • Antimicrobial Development: CrcB2 inhibitors may emerge as novel antimicrobials or sensitizing agents for conventional antibiotics.

  • Biofilm Control Strategies: Targeting CrcB2 might provide new approaches to disrupt or prevent biofilm formation in clinical and industrial settings.

  • Diagnostic Tools: Knowledge of CrcB2 variants might inform diagnostics for predicting bacterial resistance profiles.

  • Synthetic Biology Applications: Engineered CrcB2 variants might be developed for applications in biosensing or bioremediation of fluoride-contaminated environments.

  • Agricultural Applications: Modulating fluoride resistance in beneficial or pathogenic soil bacteria could have agricultural applications.

The convergence of structural insights, functional characterization, and application-driven research over the next decade will likely transform CrcB2 from a specialized research topic to a broader platform for understanding and manipulating bacterial interactions with their environment .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.