Recombinant Staphylococcus aureus Protein CrcB homolog (crcB)

What is the CrcB homolog protein in Staphylococcus aureus?

The CrcB homolog 1 (crcB1) in Staphylococcus aureus is a 147-amino acid protein identified as a putative fluoride ion transporter. It has a UniProt ID of Q6G8E8 and is also known as SAS1706. The protein contains multiple transmembrane domains and belongs to a conserved family of membrane proteins found across bacterial species . The amino acid sequence of the full-length protein is:

MHRQFLSSRCQNLFFKFKLLLFEVNQMQYVYIFIGGALGALLRYLISFLNTDGGFPIGTLIANLTGAFVMGLLTALTIAFFSNHPTLKKAITTGFLGALTTFSTFQLELIHMFDHQQFITLLLYAVTSYVFGILLCYVGIKLGGGLS

How is recombinant S. aureus CrcB homolog protein typically expressed?

Recombinant S. aureus CrcB homolog protein is most commonly expressed in E. coli expression systems using a vector that incorporates an N-terminal His-tag for purification purposes. The expression typically involves the following methodological steps:

• Cloning the crcB1 gene into an appropriate expression vector

• Transformation into competent E. coli cells

• Induction of protein expression

• Cell lysis and protein extraction

• Purification using affinity chromatography (His-tag)

• Lyophilization for storage and stability

This expression system yields a highly pure protein (>90% as determined by SDS-PAGE) that can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

What are the optimal storage conditions for recombinant CrcB homolog protein?

For optimal stability, recombinant CrcB homolog protein should be stored as follows:

Prior to opening, a brief centrifugation is recommended to bring the contents to the bottom of the vial. After reconstitution, aliquoting with glycerol addition (typically to a final concentration of 50%) helps maintain protein stability during freeze-thaw cycles .

How can I establish a functional assay for CrcB homolog protein activity as a fluoride ion transporter?

To establish a functional assay for CrcB homolog protein activity as a fluoride ion transporter, consider implementing these methodological approaches:

• Fluoride-sensitive growth assays: Express CrcB in fluoride-sensitive E. coli strains lacking endogenous fluoride exporters. Compare growth in media containing varying concentrations of NaF between CrcB-expressing strains and controls.

• Fluoride ion efflux measurements: Load bacterial cells expressing CrcB with a fluoride-sensitive fluorescent probe. Monitor fluoride efflux kinetics using fluorescence spectroscopy upon external fluoride challenge.

• Liposome reconstitution: Purify CrcB protein and reconstitute it into liposomes. Load liposomes with a fluoride-sensitive dye and measure fluoride transport across the membrane.

• Patch-clamp electrophysiology: For detailed biophysical characterization, express CrcB in a suitable expression system (e.g., Xenopus oocytes) and measure ion conductance using patch-clamp techniques.

• Isotope flux assays: Use radioactive 18F to track fluoride movement across membranes in CrcB-expressing cells versus controls.

When designing these assays, it's crucial to include appropriate controls such as known fluoride transporters (positive control), inactive CrcB mutants, and empty vector controls.

What role might CrcB homolog proteins play in S. aureus pathogenesis and colonization?

While direct evidence linking CrcB homologs to S. aureus pathogenesis is limited, several lines of evidence suggest potential roles:

• Ion homeostasis: As putative fluoride transporters, CrcB homologs likely contribute to maintaining ion balance during environmental stress, which may be critical during host colonization.

• Nasopharyngeal colonization: S. aureus adaptation during nasopharyngeal colonization involves multiple metabolic pathways. Serial passage experiments in murine nasopharyngeal colonization models have identified mutations in several metabolic genes, suggesting that adaptations in ion transport systems (potentially including CrcB) might be selected during colonization .

• Stress response network: Stress response genes (including chaperones and repair mechanisms) are under selective pressure during colonization . CrcB may participate in stress response networks, particularly in fluoride-containing environments.

• Biofilm formation: Ion transporters can influence biofilm formation by altering the local microenvironment. Investigation of CrcB's role in biofilm development may reveal colonization-relevant functions.

To investigate these potential roles experimentally, consider gene deletion/complementation studies, colonization assays using the murine nasopharyngeal model described by Salgado et al. , and transcriptional profiling under various stress conditions.

How can structural biology approaches be utilized to investigate CrcB homolog function?

Structural biology approaches offer powerful insights into CrcB homolog function. Consider the following methodological workflow:

• Protein purification optimization:

  • Use detergent screening to identify optimal solubilization conditions

  • Implement size-exclusion chromatography to ensure monodispersity

  • Validate protein folding using circular dichroism spectroscopy

• Crystallization trials:

  • Employ vapor diffusion techniques with sparse matrix screening

  • Explore lipidic cubic phase crystallization for this membrane protein

  • Consider crystallization in the presence of fluoride ions or inhibitors

• Cryo-electron microscopy (cryo-EM):

  • For challenging membrane proteins like CrcB, cryo-EM may be preferable

  • Prepare protein in nanodiscs or amphipols to maintain native conformation

  • Collect high-resolution data using direct electron detectors

• Computational structure prediction and analysis:

  • Use AlphaFold2 or RoseTTAFold to generate preliminary structural models

  • Perform molecular dynamics simulations to identify potential ion channels

  • Predict binding sites for fluoride ions through electrostatic surface mapping

• Structure-function validation:

  • Design site-directed mutagenesis experiments based on structural insights

  • Assess functional impact using fluoride transport assays

  • Confirm structural changes using biophysical techniques

These approaches should be complemented with sequence-based analyses including multiple sequence alignments with other known CrcB homologs to identify conserved functional residues.

What experimental approaches can be used to investigate CrcB homolog expression during S. aureus infection and colonization?

To investigate CrcB homolog expression during S. aureus infection and colonization, consider implementing these complementary approaches:

• In vivo transcriptomics:

  • Extract RNA from S. aureus recovered from murine nasopharyngeal colonization models at different time points

  • Perform RNA-seq analysis to determine crcB expression patterns

  • Compare expression in different infection models (e.g., bacteremia vs. nasopharyngeal colonization)

• Reporter systems:

  • Generate crcB promoter-reporter fusions (e.g., luciferase, GFP)

  • Monitor expression in live animals using bioluminescence imaging

  • Quantify expression under varying environmental conditions (pH, fluoride concentration, etc.)

• Immunological detection:

  • Develop specific antibodies against CrcB for immunohistochemistry

  • Perform Western blot analysis on samples from different infection stages

  • Use flow cytometry to quantify CrcB expression at the single-cell level

• Humanized mouse models:

  • Use immunodeficient mice reconstituted with human hematopoietic stem cells

  • These models better recapitulate human-specific aspects of S. aureus infection

  • Compare crcB expression between standard and humanized mouse models

• Environmental sensing:

  • Identify potential transcriptional regulators of crcB expression

  • Determine if fluoride or other environmental signals modulate expression

  • Create regulatory network maps incorporating crcB

This multi-faceted approach will provide a comprehensive understanding of when and where CrcB is expressed during the infectious process, potentially revealing its role in pathogenesis.

How can I design a gene knockout experiment to study CrcB homolog function in S. aureus?

For a robust gene knockout study of CrcB homolog function in S. aureus, implement the following methodological approach:

• Knockout strategy selection:

  • Allelic replacement is preferred for clean deletions without polar effects

  • CRISPR-Cas9 systems adapted for S. aureus provide efficient editing

  • Temperature-sensitive plasmids (e.g., pIMAY) offer controlled integration/excision

• Construct design:

  • Include 500-1000bp homology arms flanking the crcB gene

  • Incorporate a selectable marker (e.g., antibiotic resistance) for initial selection

  • Consider using counterselection markers (e.g., secY antisense) for marker removal

• Strain selection:

  • Use clinically relevant strains (e.g., USA300 LAC JE2 as used in colonization studies)

  • Include laboratory-adapted strains (RN4220) for initial construct validation

  • Consider creating knockouts in multiple strain backgrounds to assess strain-specific effects

• Validation approach:

  • PCR verification of the deletion

  • RT-qPCR to confirm absence of transcript

  • Whole genome sequencing to rule out off-target effects

  • Complementation with wild-type crcB to confirm phenotype specificity

• Phenotypic characterization:

  • Growth curves in standard media and with fluoride challenge

  • Murine nasopharyngeal colonization model

  • Biofilm formation assays

  • Resistance to various environmental stresses

• Controls:

  • Empty vector control for complementation studies

  • Wild-type parent strain

  • Knockout of known fluoride transporter as positive control

This comprehensive approach will provide insights into CrcB function while minimizing experimental artifacts and misinterpretation.

What considerations are important when designing experiments to investigate potential interactions between CrcB homolog and other S. aureus proteins?

When investigating protein-protein interactions involving CrcB homolog, consider these methodological approaches and critical considerations:

• In vivo interaction methods:

  • Bacterial two-hybrid assays adapted for membrane proteins

  • Split-protein complementation assays (e.g., split-GFP)

  • In vivo crosslinking followed by co-immunoprecipitation

  • Proximity-dependent biotin labeling (BioID or APEX2)

• In vitro interaction methods:

  • Pull-down assays using His-tagged CrcB

  • Surface plasmon resonance with purified components

  • Isothermal titration calorimetry for binding thermodynamics

  • Microscale thermophoresis for detecting interactions in solution

• Critical controls:

  • Non-specific binding controls (unrelated membrane proteins)

  • Detergent-only controls for membrane protein studies

  • Validation of interactions using multiple methodologies

  • Concentration-dependence studies to assess specificity

• Membrane environment considerations:

  • Use of appropriate detergents or membrane mimetics

  • Native membrane extraction techniques

  • Nanodiscs or liposomes to maintain native-like environment

  • Consideration of lipid composition effects on interactions

• Candidate selection approach:

  • Bioinformatic prediction of functional partners

  • Co-expression analysis from transcriptomic data

  • Genetic interaction studies (e.g., synthetic lethality)

  • Focus on proteins involved in ion homeostasis and stress response

• Validation of biological relevance:

  • Co-localization studies using fluorescence microscopy

  • Phenotypic characterization of interaction disruption

  • Assessment of interactions under various physiological stresses

  • Comparison across different S. aureus strains

The combination of multiple interaction detection methods and rigorous controls will provide more reliable insights into the protein interaction network of CrcB homolog.

How might CrcB homolog proteins be incorporated into S. aureus vaccine development strategies?

CrcB homolog proteins could potentially be incorporated into S. aureus vaccine development through several strategic approaches:

• Antigen selection considerations:

  • Assess surface exposure of CrcB epitopes for antibody accessibility

  • Determine conservation across clinical S. aureus strains

  • Evaluate immunogenicity of recombinant CrcB in animal models

  • Consider CrcB as part of a multi-antigen vaccine approach

• Bioconjugation strategies:

  • Utilize bioconjugation techniques to link CrcB to capsular polysaccharides

  • Explore "designer glycoconjugates" containing multiple S. aureus antigens

  • This approach has shown increased immunogenicity compared to conjugates with carrier proteins from unrelated bacteria

• Adjuvant selection:

  • CpG oligodeoxynucleotides (TLR9 agonists) have shown promise in inducing humoral and Th1/Th17 responses against S. aureus proteins

  • Consider combining with appropriate adjuvants to drive specific T cell responses

  • Evaluate adjuvant combinations that promote both antibody and cellular immunity

• Delivery systems:

  • Explore nanoparticle formulations for improved antigen presentation

  • Consider DNA vaccine approaches for endogenous expression

  • Evaluate live-attenuated vector systems expressing CrcB

• Evaluation models:

  • Utilize humanized mouse models to better predict human responses

  • Assess protection in multiple infection models (bacteremia, pneumonia, skin)

  • Evaluate nasopharyngeal colonization reduction as a key endpoint

• Immune response monitoring:

  • Characterize both humoral and cell-mediated responses

  • Assess functional antibody responses (e.g., opsonophagocytic activity)

  • Determine T cell phenotypes induced by vaccination

By integrating CrcB into these comprehensive vaccine development strategies, researchers may enhance the protective efficacy of S. aureus vaccine candidates.

What roles might CrcB homologs play in S. aureus antimicrobial resistance, and how can this be studied?

While direct evidence linking CrcB homologs to antimicrobial resistance in S. aureus is limited, several research approaches can explore this potential connection:

• Resistance correlation studies:

  • Compare crcB expression levels between susceptible and resistant clinical isolates

  • Assess whether crcB mutations correlate with resistance phenotypes

  • Analyze genomic data from experimental evolution studies under antibiotic pressure

• Ion transport and antibiotic efficacy:

  • Investigate if altered ion homeostasis through CrcB affects antibiotic uptake

  • Determine if fluoride ion transport impacts membrane potential and drug efflux

  • Assess synergy between fluoride compounds and conventional antibiotics

• Gene knockout approach:

  • Generate crcB deletion mutants and determine minimal inhibitory concentrations

  • Perform time-kill assays with various antibiotic classes

  • Assess impact on biofilm-associated resistance

  • Evaluate persister cell formation in crcB mutants

• Evolutionary studies:

  • Implement experimental evolution approaches similar to the nasopharyngeal model

  • Apply antibiotic selection pressure and monitor for crcB mutations

  • Use directed evolution to identify mutations conferring resistance

  • Perform whole genome sequencing to identify co-evolving loci

• Stress response connection:

  • Assess if crcB contributes to general stress responses that promote survival

  • Determine if fluoride stress cross-protects against antibiotics

  • Investigate potential regulatory overlap between stress and resistance mechanisms

• Translational potential:

  • Evaluate CrcB inhibitors as potential antibiotic adjuvants

  • Assess combination therapies targeting ion homeostasis and conventional targets

  • Develop screening platforms for compounds affecting CrcB function

These approaches will provide a comprehensive understanding of how CrcB homologs might contribute to antimicrobial resistance in S. aureus.

What are the most effective protein purification strategies for obtaining high-quality recombinant CrcB homolog for structural studies?

For obtaining high-quality recombinant CrcB homolog suitable for structural studies, implement this optimized purification workflow:

• Expression optimization:

  • Test multiple expression strains (BL21(DE3), C41/C43, Rosetta)

  • Optimize induction conditions (temperature, IPTG concentration, duration)

  • Consider auto-induction media for gentle, high-density expression

  • Evaluate fusion tags beyond His-tag (MBP, SUMO) to improve solubility

• Membrane extraction:

  • Use gentle cell disruption methods (e.g., French press or sonication with cooling)

  • Isolate membranes through differential ultracentrifugation

  • Carefully optimize detergent screening (start with DDM, LMNG, or GDN)

  • Consider native membrane nanodiscs for extraction

• Affinity purification:

  • Implement IMAC using Ni-NTA for His-tagged protein

  • Include low concentrations of detergent in all buffers

  • Use stepwise imidazole gradient for higher purity

  • Consider on-column detergent exchange if needed

• Secondary purification:

  • Size-exclusion chromatography to ensure monodispersity

  • Ion-exchange chromatography for removing contaminants

  • Affinity chromatography with specific ligands if available

• Quality assessment:

  • SEC-MALS to determine oligomeric state and homogeneity

  • Thermal stability assays (DSF/nanoDSF) to optimize buffer conditions

  • Negative-stain EM to verify sample quality before cryo-EM

  • Functional assays to confirm that purified protein retains activity

• Sample preparation for structural studies:

  • Concentrate to 5-15 mg/mL depending on technique

  • Remove aggregates by ultracentrifugation before crystallization

  • For cryo-EM, optimize grid preparation (concentration, blotting time)

  • Consider lipid cubic phase methods for crystallization

This comprehensive purification strategy will maximize the likelihood of obtaining homogeneous, functional CrcB protein suitable for high-resolution structural studies.

How can I develop a high-throughput screening assay to identify inhibitors of CrcB homolog function?

To develop a robust high-throughput screening (HTS) assay for identifying CrcB homolog inhibitors, implement this methodological approach:

• Primary assay development:

  • Fluoride-sensitive reporter system: Engineer bacterial cells expressing CrcB with a fluoride-responsive promoter driving fluorescent protein expression

  • Ion-sensitive fluorescent probes: Load cells or proteoliposomes with fluoride-sensitive dyes that change fluorescence upon fluoride flux

  • Growth inhibition readout: Monitor bacterial growth in fluoride-containing media, where CrcB inhibition would increase fluoride sensitivity

• Assay optimization for HTS:

  • Miniaturize to 384 or 1536-well format

  • Establish robust Z'-factor (aim for >0.5) by testing with known controls

  • Optimize signal-to-background ratio and minimize variability

  • Determine DMSO tolerance (typically keep <1%)

  • Establish positive controls (known ion channel blockers) and negative controls

• Screening library selection:

  • Consider membrane-permeant compounds for cellular assays

  • Include known ion channel modulators as privileged scaffolds

  • Diversity-oriented collections to cover broad chemical space

  • Natural product libraries may yield novel scaffolds

• HTS implementation:

  • Include replicate testing for hit confirmation

  • Use multiple concentrations or follow up with dose-response testing

  • Implement quality control metrics for each plate (controls in expected ranges)

  • Consider orthogonal screening approaches in parallel for cross-validation

• Hit validation and counter-screening:

  • Secondary assays with purified protein in proteoliposomes

  • Counter-screens against other ion transporters to establish selectivity

  • Cytotoxicity assessment in mammalian cells

  • Direct binding assays (SPR, ITC) to confirm target engagement

• Optimization workflow:

  • Structure-activity relationship studies of confirmed hits

  • Medicinal chemistry optimization for potency and selectivity

  • Assessment of physicochemical and ADME properties

  • In vivo validation in S. aureus infection models

This comprehensive HTS development strategy will facilitate the identification of specific inhibitors targeting CrcB homolog function for potential therapeutic development.