Recombinant Staphylococcus aureus Protein flp (flp)

Shipped with Ice Packs
In Stock

Description

Definition and Genetic Context

The flp gene in S. aureus encodes a 489-amino-acid protein (56.4 kDa) with three conserved motifs found in PBPs and beta-lactamases . Despite structural similarities to PBPs, recombinant FLP lacks penicillin-binding activity, and its inactivation in methicillin-resistant S. aureus (MRSA) strains does not reduce methicillin resistance . The protein is alternatively termed "FmtA-like protein" due to its homology with FmtA, another protein linked to methicillin resistance modulation .

Role in Cell Wall Synthesis

FLP’s conserved motifs suggest involvement in cell wall metabolism, but experimental studies contradict this hypothesis:

  • Recombinant FLP lacks detectable penicillin-binding or beta-lactamase activity .

  • Gene knockout in MRSA strains (e.g., COL, N315) does not alter methicillin resistance profiles .

Immunological Potential

While FLP itself is not directly linked to vaccine development, related S. aureus proteins (e.g., FnBP, ClfA) have shown promise as vaccine antigens . FLP’s surface accessibility and conserved structure make it a candidate for further study, though no protective epitopes have been identified yet .

Recombinant Production and Applications

Commercial recombinant FLP variants are available for research purposes, with specifications including:

VariantStrain SourceUniProt IDKey Features
FLP (strain COL)COLQ6G6M9Lyophilized, >90% purity, His-tagged
FLP (strain N315)N315Q9KJ74Full-length (1-498 aa), SDS-PAGE verified

These proteins are used in structural studies, antibody production, and exploratory vaccine research, though they are explicitly labeled "Not For Human Consumption" .

Comparative Analysis with Related Proteins

FLP’s functional ambiguity contrasts with other S. aureus virulence factors:

ProteinFunctionVaccine Potential
FLPPutative cell wall synthesisUnder investigation
FnBP/ClfAFibronectin binding, biofilm formationValidated antigens
CgoX/TPIHeme synthesis, glycolysisProtective in murine models

Research Gaps and Future Directions

  • Mechanistic Role: FLP’s exact enzymatic or structural role in S. aureus remains unclear.

  • Immunogenicity: No studies have yet tested FLP as a vaccine antigen, unlike related proteins .

  • Structural Studies: High-resolution crystallography could clarify its conserved motifs’ functions .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You may use this as a reference for your specific needs.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquot the protein. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing your desired tag.
Synonyms
flp; SAOUHSC_02736; Protein flp; FmtA-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-498
Protein Length
full length protein
Species
Staphylococcus aureus (strain NCTC 8325)
Target Names
flp
Target Protein Sequence
MTTKKLYFLSISIIILVAISIAIYITLNSNTKTRLTNDSQQQIDTIIEHDLQKGHIPGAS ILIVKNGKVFLNKGYGYQDVDKKVKASPTTKYEIASNTKAFTGLAILKLAQEGRLNLNDA VSKHVPHFKMNYNGQNETITIKQLLAQTSGIPSDITSEDSVTSKNNRLNDVTHAIMGDEL HHKPGEEFEYSNMNYDLLGLIIQNVTKQSYTKYITNSWLKPLHMTHTSFKQTNYKSKHDA IGYELQGSTPVVSKPEFNLWDTPSAYMMTSTEDLEHWIKFQLNPPDKYKSLVQQSHKNLS STIGEPNANAYASGWFTNNDEHLVFHSGTLDNFSSFILLNPKQNYGIVVLANLNSEYVPK LVEHLNTQIVNHKRYSTVASMLNQYKDQFNIVTVLMTTLILLAFIFSAYRAWQMRHGQIL LRRSKRIAVLSWLSLCICIALALILYALPYLILGSNNWSFVLTWLPIEIKLALITTLIAL FSTLIVILLFLHTKITKT
Uniprot No.

Target Background

Function
The exact function of this protein is currently unknown. It does not exhibit penicillin-binding activity and is not implicated in methicillin resistance.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does Protein Flp relate to other virulence factors in S. aureus?

S. aureus expresses several key virulence factors that contribute to its pathogenicity, including FnBP and ClfA. While Flp has distinct functions, researchers should understand the interplay between these factors when designing comprehensive studies:

Virulence FactorFunctionRelevance to Research
Flp (FmtA-like protein)Membrane protein with potential roles in cell wall synthesisTarget for structural and functional studies
FnBPBinds to plasminogen and promotes biofilm formationKey adhesion factor for infection models
ClfABinds to complement factor I, promotes evasion of neutrophil killingImportant for immune evasion studies

FnBP and ClfA have been shown to promote S. aureus adhesion to breast tissue and are important targets for vaccine development. Antibodies induced against these proteins can partially block bacterial adhesion .

What bioinformatic approaches can be used to predict epitopes and structural features of Protein Flp?

Researchers can employ multiple computational approaches to predict immunogenic and structural features of Protein Flp:

When analyzing potential epitopes, researchers should examine propensity indices (values >0.9 typically indicate good candidates) and consider multiple epitopes to ensure comprehensive coverage for immunological studies .

What are the optimal conditions for reconstitution and storage of recombinant Protein Flp?

For optimal handling of recombinant Protein Flp, follow these research-validated protocols:

Reconstitution Protocol:

  • Centrifuge the vial briefly before opening to ensure all material is at the bottom.

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (recommended 50%) for long-term storage stability.

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles.

Storage Conditions:

  • Store lyophilized protein at -20°C/-80°C upon receipt.

  • Store reconstituted working aliquots at 4°C for up to one week.

  • For long-term storage, keep aliquots at -20°C/-80°C.

  • Avoid repeated freeze-thaw cycles as these significantly impact protein stability and activity.

The protein is typically supplied in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability during storage .

How can researchers confirm direct binding of compounds to S. aureus proteins in cellular contexts?

To verify compound-protein interactions in cellular contexts, the Cellular Thermal Shift Assay (CETSA) has proven effective in recent S. aureus protein research:

CETSA Protocol for S. aureus Proteins:

  • Culture S. aureus strain (e.g., 8325-4) with your compound of interest (typically at 10 μM concentration).

  • Process cells according to standard CETSA protocols.

  • Analyze thermal stability shifts of the target protein.

  • Include appropriate controls (DMSO vehicle and known binders).

A significant increase in the thermal stability (Tm) of the target protein indicates direct binding of the compound to the protein in the cellular environment. This method has been successfully employed to demonstrate binding of compounds like (R)- and (S)-ZG197 to ClpP in S. aureus cells .

What expression systems are most effective for producing functional recombinant Protein Flp?

E. coli is the established expression system for producing recombinant S. aureus Protein Flp with high yield and purity. The methodological approach includes:

Expression Optimization:

  • Clone the flp gene into an appropriate expression vector (pET28a or pET32a are commonly used).

  • Transform the construct into a compatible E. coli strain.

  • Induce protein expression under optimized conditions.

  • Purify using affinity chromatography targeting the His-tag.

For enhanced solubility and function, researchers should consider:

  • Using BL21(DE3) or Rosetta strains for expression

  • Optimizing induction temperature (typically 16-25°C for membrane proteins)

  • Adding solubility enhancers such as sorbitol or trehalose to the growth medium

  • Including appropriate detergents during purification if working with the full-length protein including transmembrane domains

How can Protein Flp be incorporated into multi-antigen constructs for vaccine development?

Recent research demonstrates successful approaches for incorporating S. aureus proteins into multi-antigen constructs:

Design Strategy for Fusion Constructs:

  • Identify immunogenic epitopes using bioinformatic prediction tools.

  • Select protein fragments with optimal immunogenicity.

  • Engineer constructs with appropriate linker sequences (-GGGGSGGGGSGGGGS-) to maintain proper folding of each domain.

  • Express and purify the fusion proteins using established protocols.

This approach has been successfully applied to create fusion proteins combining virulence factors from S. aureus (FnBP and ClfA) with those from S. agalactiae (GapC and Sip). The resulting chimeric proteins induced high antibody levels in mice and provided protection against bacterial challenge .

When designing fusion constructs including Protein Flp, researchers should carefully analyze its epitope structure and consider its incorporation with other relevant S. aureus virulence factors for comprehensive coverage.

What methods can be used to evaluate the functional activity of recombinant Protein Flp?

To assess the functional activity of recombinant Protein Flp, researchers can employ several complementary approaches:

In vitro Activity Assays:

  • Protein-protein interaction studies using surface plasmon resonance (SPR)

  • Enzymatic activity assays if specific enzymatic functions are identified

  • Binding assays to potential substrates or interaction partners

Cellular Functional Assays:

  • Bacterial adhesion assays to relevant cell types

  • Biofilm formation assessment in the presence/absence of anti-Flp antibodies

  • Cell invasion assays to determine the contribution of Flp to virulence

Immunological Assessment:

  • Antibody production evaluation following immunization with recombinant Flp

  • Protection studies in appropriate animal models

  • Neutralization assays to determine if anti-Flp antibodies can block specific functions

These methodological approaches have been applied successfully to other S. aureus virulence factors and can be adapted for Protein Flp research .

How can researchers develop selective modulators of S. aureus proteins while avoiding cross-reactivity with human homologs?

A structure-based design approach has proven successful for developing selective modulators of S. aureus proteins:

Structure-Based Design Methodology:

  • Identify structural differences between bacterial and human protein homologs.

  • Focus on key structural elements that contribute to species selectivity.

  • Design compounds that exploit these differences.

  • Validate selectivity through comparative binding and functional assays.

Recent research has identified the importance of specific structural elements in human ClpP, particularly W146 and its interaction with the C-terminal motif, which significantly contribute to discriminating between bacterial and human activators. This approach led to the development of (R)- and (S)-ZG197 as highly selective S. aureus ClpP activators .

For Protein Flp research, similar structure-based approaches could be employed to develop selective modulators, particularly if structural data becomes available.

What are common challenges in purifying functional recombinant Protein Flp and how can they be addressed?

Researchers working with recombinant Protein Flp may encounter several challenges during purification:

ChallengePotential SolutionMethodological Approach
Low solubilityOptimize extraction conditionsUse mild detergents (0.1-1% NP-40 or Triton X-100); Extract at 4°C; Consider extraction with different pH buffers
Protein aggregationModify buffer compositionAdd stabilizers like glycerol (10-20%); Optimize salt concentration (150-500 mM NaCl); Include reducing agents (1-5 mM DTT or BME)
Low purityEnhance purification strategyImplement two-step purification combining affinity chromatography with size exclusion or ion exchange; Consider on-column refolding techniques
DegradationImprove protein stabilityInclude protease inhibitors during all steps; Work at 4°C throughout; Minimize processing time

For membrane-associated proteins like Flp, inclusion of appropriate detergents during extraction and purification is particularly critical for maintaining native conformation and function .

How can immunization protocols with recombinant S. aureus proteins be optimized for maximum efficacy?

Based on successful approaches with S. aureus protein immunization, researchers should consider the following protocol optimizations:

Immunization Protocol Optimization:

  • Adjuvant selection: Freund's complete adjuvant for primary immunization followed by incomplete adjuvant for boosters has shown efficacy in mouse models.

  • Dosing schedule: Primary immunization followed by 2-3 boosters at 2-week intervals.

  • Antigen concentration: 50-100 μg per immunization for mice has demonstrated good antibody responses.

  • Route of administration: Subcutaneous or intraperitoneal administration depending on the experimental design.

Assessment of Immune Response:

  • Measure antibody titers using ELISA 7-10 days after the final boost.

  • Assess functional activity of antibodies through neutralization assays.

  • Evaluate protection through bacterial challenge models.

In mouse studies with chimeric S. aureus proteins, this approach induced high antibody levels and provided significant protection against bacterial challenge, with reduced bacterial loads in the spleen and liver following infection .

How can researchers address experimental inconsistencies when comparing in vitro and in vivo results with S. aureus proteins?

When confronting discrepancies between in vitro and in vivo findings, researchers should consider these methodological approaches:

Systematic Troubleshooting Framework:

  • Evaluate protein quality: Confirm proper folding and activity of the recombinant protein using biophysical and functional assays.

  • Review experimental conditions: Assess whether in vitro conditions appropriately mimic physiological environments.

  • Consider host factors: Analyze the contribution of host-specific factors absent in in vitro systems.

  • Examine dosing parameters: Ensure that concentrations used in vitro are achievable and relevant in vivo.

Bridging Strategies:

  • Implement ex vivo models as intermediary systems between in vitro and in vivo studies.

  • Use multiple animal models to validate findings and account for species-specific differences.

  • Conduct comprehensive pharmacokinetic studies to understand protein behavior in vivo.

Research with other S. aureus virulence factors has demonstrated that fusion proteins effective in inducing antibody responses in vitro also provided protection in mouse challenge models, suggesting that well-designed recombinant proteins can bridge in vitro to in vivo translation successfully .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.