Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, should you have specific format preferences, please indicate your requirements during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Kindly consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate this to us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can utilize this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
mnhB2; mrpB2; SaurJH9_0646; Putative antiporter subunit mnhB2; Mrp complex subunit B2; Putative NADH-ubiquinone oxidoreductase subunit mnhB2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Staphylococcus aureus (strain JH9)
Target Names
mnhB2
Target Protein Sequence
MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEV LESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELG ILFSVVGVIVTVMLSLSGGRS
Uniprot No.

Target Background

Database Links
Protein Families
CPA3 antiporters (TC 2.A.63) subunit B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is mnhB2 and what is its functional role in Staphylococcus aureus?

MnhB2 is a putative antiporter subunit of the Mnh2 complex in Staphylococcus aureus. It belongs to a cluster of seven hydrophobic membrane-bound protein subunits that together form a functional cation/proton antiporter system. The Mnh2 antiporter system demonstrates significant exchange of both Na+/H+ and K+/H+ cations, particularly at alkaline pH (approximately 8.5) . As part of this complex, mnhB2 contributes to maintaining cytoplasmic pH homeostasis, enabling S. aureus to survive under extreme environmental stress conditions, particularly alkaline environments.

The mnhB2 subunit is encoded by the mnhB2 gene (also known as mrpB2 in some nomenclature systems) and is part of the Mnh2 operon. These multisubunit antiporters play essential roles in bacterial physiology by regulating internal ion concentrations and pH, which are critical for numerous cellular processes and stress adaptations.

How is recombinant mnhB2 typically expressed for research purposes?

Recombinant mnhB2 is typically expressed using an in vitro E. coli expression system . For research applications, the protein is commonly produced with an N-terminal 10xHis tag to facilitate purification through affinity chromatography. The recombinant protein is available in either liquid or lyophilized powder form depending on research requirements.

The production process typically involves cloning the full-length protein or the expressed region (positions 1-141) into an appropriate expression vector, transforming into an E. coli host, inducing expression, and then purifying using methods like immobilized metal affinity chromatography (IMAC) to isolate the His-tagged protein.

What are the optimal storage conditions for recombinant mnhB2?

For maximum stability and activity retention, recombinant mnhB2 should be stored at -20°C or preferably -80°C upon receipt . Due to the protein's susceptibility to degradation from repeated freeze-thaw cycles, aliquoting is strongly recommended for multiple use scenarios.

The shelf life varies depending on the formulation:

  • Liquid form: Approximately 6 months at -20°C/-80°C

  • Lyophilized form: Up to 12 months at -20°C/-80°C

When working with the protein, it's advisable to keep working aliquots at 4°C for no longer than one week. For reconstitution of lyophilized protein, it is recommended to briefly spin the vial and bring contents to the bottom prior to opening, then reconstitute at 0.5-1.0 mg/mL with sterile deionized water .

How do the Mnh1 and Mnh2 antiporter systems differ in their catalytic properties?

The Mnh1 and Mnh2 antiporter systems in S. aureus demonstrate distinct catalytic properties that reflect their specialized physiological roles:

PropertyMnh1 AntiporterMnh2 Antiporter
Cation exchange specificityPrimarily Na+/H+Both Na+/H+ and K+/H+
Optimal pH for activitypH 7.5pH 8.5
Role in stress responseSignificant for salt toleranceImportant for alkali tolerance
Genetic organization7 membrane-bound subunits7 membrane-bound subunits
Measurement methodologyEverted vesicles (inside out)Everted vesicles (inside out)

The Mnh1 antiporter exhibits significant exchange of Na+/H+ cations at pH 7.5, while Mnh2 (which includes the mnhB2 subunit) shows significant exchange of both Na+/H+ and K+/H+ cations, especially at higher pH values around 8.5 . This functional distinction suggests that Mnh2 plays a more significant role in pH homeostasis under alkaline conditions, whereas Mnh1 may be more important under neutral pH conditions. Under elevated salt conditions, deletion of the mnhA1 gene (from the Mnh1 complex) results in a significant reduction of growth rate in S. aureus, highlighting its importance in salt tolerance .

What experimental approaches are recommended for studying mnhB2 function within the complete Mnh2 complex?

Several sophisticated experimental approaches can be employed to study mnhB2 function within the Mnh2 complex:

  • Heterologous Expression Systems: Clone the entire Mnh2 antiporter complex into an expression vector (such as pGEM3Z+) and express it in an antiporter-deficient strain (like KNabc E. coli) . This approach allows for functional studies without interference from endogenous antiporters.

  • Everted Vesicle Assays: Prepare inside-out membrane vesicles from cells expressing the Mnh2 complex to measure ion transport activities under various conditions . This methodology enables direct assessment of cation/proton exchange rates by monitoring pH changes or cation movements across the membrane.

  • Gene Deletion and Complementation Studies: Create mnhB2 deletion mutants in S. aureus and assess phenotypic changes related to pH tolerance, cation sensitivity, and growth under various stress conditions. Complementation with wild-type or mutated mnhB2 can confirm the specific contribution of this subunit.

  • Site-Directed Mutagenesis: Introduce specific mutations in conserved or predicted functional domains of mnhB2 to identify critical residues for antiporter function, assembly, or regulation.

  • Protein-Protein Interaction Studies: Employ techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or crosslinking followed by mass spectrometry to investigate interactions between mnhB2 and other subunits of the Mnh2 complex.

How can researchers effectively analyze data from cation/proton exchange assays involving the Mnh2 complex?

Effective data analysis for cation/proton exchange assays requires rigorous experimental design and careful interpretation:

How might mnhB2 and the Mnh2 antiporter system contribute to S. aureus pathogenesis and antimicrobial resistance?

While the search results don't directly link mnhB2 to antimicrobial resistance, several mechanisms can be hypothesized based on the role of cation/proton antiporters in bacterial physiology:

  • pH Homeostasis During Infection: The ability to maintain internal pH during infection is critical for S. aureus pathogenesis. The Mnh2 antiporter, with mnhB2 as a component, may enable S. aureus to adapt to alkaline environments encountered during infection, such as in certain host tissues or in response to host defense mechanisms.

  • Stress Response Coordination: Ion homeostasis systems often intersect with stress response pathways. The Mnh2 system might contribute to the bacterium's ability to survive hostile host environments, including those with antimicrobial peptides or other stressors.

  • Indirect Effects on Resistance Mechanisms: While distinct from direct antibiotic resistance mechanisms like those mediated by mecA and PBP2a in MRSA strains , the maintenance of physiological pH and ion balance through antiporters like Mnh2 could indirectly support the function of resistance mechanisms by maintaining optimal cellular conditions.

  • Biofilm Formation: Ion homeostasis may influence biofilm formation, a key virulence factor that contributes to antibiotic tolerance. The Mnh2 system could potentially play a role in this process through regulation of ionic conditions.

Further research is needed to establish direct connections between the Mnh2 antiporter system and specific virulence or resistance mechanisms in S. aureus.

What structural and functional methodologies would be most appropriate for investigating the membrane topology of mnhB2?

Understanding the membrane topology of mnhB2 requires specialized techniques for membrane protein analysis:

  • Cysteine Scanning Mutagenesis: Introduce cysteine residues at various positions in mnhB2 and determine their accessibility to membrane-impermeable sulfhydryl reagents. This approach can identify transmembrane segments and their orientation.

  • Fluorescence Resonance Energy Transfer (FRET): Label specific residues with fluorescent probes to determine proximity relationships between different regions of mnhB2 and between mnhB2 and other subunits.

  • Protease Protection Assays: Expose membrane preparations containing mnhB2 to proteases and identify protected fragments to map membrane-embedded regions.

  • Computational Predictions: Use bioinformatics tools designed for membrane protein topology prediction (e.g., TMHMM, PredictProtein) as a starting point for experimental validation.

  • Cryo-Electron Microscopy: While challenging for individual subunits, cryo-EM of the entire Mnh2 complex might provide structural insights into the organization of subunits, including mnhB2.

  • Reporter Fusion Proteins: Create fusions of mnhB2 with reporter proteins (e.g., GFP, alkaline phosphatase) at various positions to determine the cellular localization of different regions.

These methodologies, used in combination, would provide comprehensive information about the structural organization of mnhB2 within the membrane and its relationship to function within the Mnh2 complex.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.