Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2)

Shipped with Ice Packs
In Stock

Description

Introduction to Staphylococcus aureus

Staphylococcus aureus is a gram-positive, spherically shaped bacterium belonging to the Bacillota phylum. It commonly exists as part of the normal human microbiota, particularly in the upper respiratory tract and on the skin. This facultative anaerobe can grow with or without oxygen and is catalase-positive and nitrate reduction-positive . Despite its common presence as a commensal organism, S. aureus can transform into an opportunistic pathogen, causing a spectrum of illnesses ranging from minor skin infections to life-threatening conditions including pneumonia, meningitis, osteomyelitis, endocarditis, toxic shock syndrome, bacteremia, and sepsis .

The pathogenicity of S. aureus stems from its production of various virulence factors, including potent protein toxins and cell-surface proteins that bind and inactivate antibodies . These mechanisms allow the bacterium to evade host immune responses effectively. The clinical significance of S. aureus has been amplified by the emergence of antibiotic-resistant strains, most notably methicillin-resistant S. aureus (MRSA), making it one of the leading pathogens associated with antimicrobial resistance-related deaths . Despite extensive research efforts, no approved vaccine for S. aureus exists, highlighting the complexity of this organism and the challenges in combating its infections .

Epidemiology and Clinical Impact

S. aureus colonizes approximately 21% to 30% of the human population as long-term carriers . In the United States alone, an estimated 500,000 hospital patients contract staphylococcal infections annually, predominantly caused by S. aureus, with up to 50,000 deaths linked to these infections each year . The bacterium's ability to cause disease across multiple body sites, combined with its increasing resistance to antimicrobial agents, presents a significant global health challenge that necessitates ongoing research into its cellular components and mechanisms.

Classification of S. aureus Antiporters

Staphylococcus aureus possesses three distinct types of cation/proton antiporters, with the type 3 family including two sodium/proton (Na+/H+) antiporters, designated as Mnh1 and Mnh2 . These antiporters function as essential components of the bacterial cell's ion transport system, facilitating the exchange of cations across the cell membrane to maintain optimal intracellular conditions.

Functional Importance of Antiporters

Mnh antiporters play crucial roles in maintaining cytoplasmic pH in prokaryotes, enabling bacterial survival under extreme environmental stress conditions . These membrane transport systems facilitate the exchange of sodium or potassium ions for hydrogen ions across the cell membrane, effectively regulating intracellular pH and ion concentrations. This homeostatic mechanism is particularly important for pathogenic bacteria like S. aureus, which must adapt to varying host environments with different pH and salt concentrations during the infection process.

Expression and Purification

For research applications, the recombinant mnhC2 protein can be expressed in several systems, with E. coli being a common host due to its simplicity and high yield potential . The purification of this protein typically involves affinity chromatography techniques to isolate the target protein from host cell contaminants. The resulting purified recombinant protein provides a valuable tool for studying the structure and function of this specific antiporter subunit.

Ion Exchange Specificity

Research into the catalytic properties of Mnh1 and Mnh2 antiporters has revealed distinct substrate preferences and pH-dependent activities. The Mnh1 antiporter primarily facilitates Na+/H+ exchange, showing significant activity at pH 7.5 . In contrast, the Mnh2 antiporter, which includes the mnhC2 subunit, demonstrates broader substrate specificity, exchanging both Na+/H+ and K+/H+ cations with particularly notable activity at pH 8.5 .

Role in pH Tolerance

The differential pH preferences of Mnh1 and Mnh2 antiporters suggest complementary roles in maintaining cellular pH homeostasis across varying environmental conditions. Experimental evidence from gene deletion studies supports this notion, as deletion of the mnhA1 gene (from Mnh1) results in significant growth reduction for S. aureus in environments with pH ranging from 7.5 to 9.0 . Conversely, deletion of mnhA2 (from Mnh2) primarily affects growth at more alkaline pH ranges of 8.5 to 9.5 .

Table 1: Comparative Function of Mnh1 and Mnh2 Antiporters

PropertyMnh1 AntiporterMnh2 Antiporter (containing mnhC2)
Cation ExchangeNa+/H+Na+/H+ and K+/H+
Optimal pH Activity7.58.5
pH Range for Significant Growth Impact (when deleted)7.5-9.08.5-9.5
Role in VirulenceMajorMinor/None

Salt Tolerance and Osmoadaptation

Both Mnh1 and Mnh2 antiporters contribute to S. aureus halotolerance, allowing the bacterium to survive in environments with elevated salt concentrations . The combined action of these antiporters provides S. aureus with a robust defense mechanism against osmotic stress. When both antiporter systems are compromised through gene deletions, S. aureus exhibits severely reduced growth capacity, particularly at pH values above 8.5 . This indicates a synergistic relationship between the two antiporter systems, with each potentially compensating for the other's absence under certain conditions.

Contribution to Virulence

In vivo infection models using mice have demonstrated that the Mnh1 and Mnh2 antiporters contribute differently to S. aureus virulence. Deletion of the mnhA1 gene leads to a significant reduction in virulence, whereas deletion of mnhA2 does not noticeably affect virulence . This suggests that while the Mnh2 system (including the mnhC2 subunit) may contribute to bacterial survival under specific environmental conditions, it may not be as critical as Mnh1 for establishing and maintaining infection in mammalian hosts.

Table 2: Effects of Mnh Gene Deletions on S. aureus

Gene DeletionGrowth ImpactVirulence Impact in Mouse Model
mnhA1 (Mnh1)Reduced growth at pH 7.5-9.0Major reduction in virulence
mnhA2 (Mnh2)Reduced growth at pH 8.5-9.5No significant change in virulence
Double deletion (mnhA1 + mnhA2)Severely reduced growth, especially above pH 8.5Not specified in available data

Antibiotic Resistance Studies

Understanding the function of membrane transport systems, including the Mnh antiporters and their component subunits like mnhC2, may provide insights into bacterial survival mechanisms that contribute to antibiotic resistance. S. aureus has developed multiple mechanisms to evade antimicrobial agents, making it one of the leading pathogens associated with antimicrobial resistance-related deaths . Research into the fundamental cellular processes of this bacterium, including ion transport systems, could potentially identify novel targets for therapeutic intervention.

Research Limitations

It is crucial to emphasize that recombinant proteins like the S. aureus mnhC2 are strictly limited to research applications and cannot be used directly on humans or animals . These materials serve as tools for understanding bacterial physiology, pathogenicity mechanisms, and potential intervention strategies, but require extensive development and testing before any clinical applications can be considered.

Knowledge Gaps and Research Opportunities

While considerable progress has been made in understanding the general functions of Mnh antiporters in S. aureus, specific details regarding the individual contributions of each subunit, including mnhC2, remain to be fully elucidated. Future research focusing on the structural characterization of these subunits and their interactions within the larger antiporter complex would provide valuable insights into their precise mechanisms of action.

Potential Therapeutic Applications

The critical roles of Mnh antiporters in bacterial pH homeostasis and stress response suggest that these systems could represent promising targets for novel antimicrobial strategies. Compounds that specifically inhibit the function of these antiporters might compromise the ability of S. aureus to adapt to changing environmental conditions, potentially reducing its virulence and survival within the host. The differential contributions of Mnh1 and Mnh2 to bacterial virulence also suggest that targeted approaches focusing on specific antiporter systems might offer selective antimicrobial effects.

Technological Advances in Antiporter Research

Continued advancements in structural biology techniques, including cryo-electron microscopy and X-ray crystallography, present opportunities for more detailed characterization of membrane proteins like mnhC2. These approaches, combined with functional assays and genetic manipulation studies, will continue to enhance our understanding of these complex bacterial transport systems and their potential as therapeutic targets.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
mnhC2; mrpC2; SaurJH9_0647; Putative antiporter subunit mnhC2; Mrp complex subunit C2; Putative NADH-ubiquinone oxidoreductase subunit mnhC2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Staphylococcus aureus (strain JH9)
Target Names
mnhC2
Target Protein Sequence
MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITG GNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK
Uniprot No.

Target Background

Database Links
Protein Families
CPA3 antiporters (TC 2.A.63) subunit C family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the MnhC2 subunit and how does it function within S. aureus?

MnhC2 is one of seven hydrophobic membrane-bound protein subunits that collectively form the Mnh2 cation/proton antiporter in Staphylococcus aureus. This subunit is part of the type 3 family of cation/proton antiporters that plays a critical role in maintaining cytoplasmic pH homeostasis under environmental stress conditions. The Mnh2 antiporter complex, which includes the mnhC2 subunit, demonstrates significant exchange activity for both Na+/H+ and K+/H+ cations, particularly at alkaline pH ranges (pH 8.5 and above). This function is essential for S. aureus adaptation to high salt environments and alkaline conditions that would otherwise be inhibitory to bacterial growth .

Research methodologies examining the functional contribution of individual subunits typically involve genetic approaches such as gene deletion studies and complementation assays. Experimental evidence indicates that the Mnh2 complex, including the mnhC2 subunit, contributes significantly to S. aureus growth under elevated salt conditions, particularly at pH values between 8.5 and 9.5 .

How is the Mnh2 antiporter system structurally organized?

The genetic organization of the Mnh2 system requires the coordinated expression of multiple genes to produce a functional antiporter complex. This is evidenced by deletion studies showing that most (approximately 6 kbp) of the DNA sequence encoding the Mnh system is necessary for conferring salt tolerance when expressed in antiporter-deficient E. coli strains . The complex organization likely contributes to the sophisticated regulation and ion specificity demonstrated by the Mnh2 system.

What distinguishes the Mnh2 antiporter from other cation/proton antiporters in S. aureus?

S. aureus possesses three types of cation/proton antiporters, with the type 3 family including both Mnh1 and Mnh2 antiporters. The Mnh2 antiporter demonstrates distinctive properties that differentiate it from Mnh1 and other antiporter systems. Key distinguishing features include:

  • Cation specificity: While Mnh1 primarily exhibits Na+/H+ exchange activity, Mnh2 shows significant exchange activity for both Na+/H+ and K+/H+ cations .

  • pH-dependent activity: Mnh2 shows optimal activity at pH 8.5, whereas Mnh1 functions optimally at pH 7.5 .

  • Physiological role: Mnh2 contributes primarily to osmotolerance and halotolerance at alkaline pH (8.5-9.5), while Mnh1 functions in a broader pH range (7.5-9.0) .

  • Impact on virulence: Unlike Mnh1, deletion of Mnh2 genes does not significantly affect S. aureus virulence in mouse infection models .

  • Activity profile: The Mnh2 antiporter exhibits measurable activity at neutral pH (pH 7.0), distinguishing it from NhaA-type antiporters from E. coli or V. parahaemolyticus, which show minimal activity at neutral pH but high activity at pH 8.5 .

What approaches are recommended for cloning and expressing recombinant MnhC2?

When cloning and expressing recombinant mnhC2, researchers should consider the following methodological approaches based on successful protocols used with Mnh antiporter systems:

  • Vector selection: Plasmid vectors like pGEM3Z+ have been successfully used for cloning Mnh antiporter genes from S. aureus. This vector provides appropriate expression control elements for bacterial systems .

  • Host strain selection: Antiporter-deficient strains such as the KNabc E. coli strain (lacking the nhaA, nhaB, and chaA antiporter genes) provide an ideal background for functional expression and characterization of recombinant antiporter subunits. This approach eliminates interference from endogenous antiporter activities .

  • Expression validation: When expressing mnhC2, researchers should verify proper protein production and membrane localization using techniques such as Western blotting with specific antibodies and membrane fractionation procedures.

  • Complementation approach: A robust method for confirming functional expression involves complementation of salt sensitivity in antiporter-deficient strains. Growth assays in media containing elevated NaCl (0.2 M to 0.8 M) or LiCl (0.1 M to 0.4 M) concentrations can demonstrate the restoration of salt tolerance through the functional activity of the expressed antiporter system .

  • Co-expression considerations: Since mnhC2 functions as part of a multisubunit complex, co-expression with other subunits of the Mnh2 system may be necessary to achieve proper folding, membrane insertion, and functional activity .

How can researchers assess the functional activity of MnhC2 and the Mnh2 antiporter complex?

Functional assessment of mnhC2 as part of the Mnh2 antiporter complex can be accomplished through several experimental approaches:

  • Preparation of everted membrane vesicles: This technique involves the creation of inside-out membrane vesicles from cells expressing the antiporter complex. These vesicles expose the cytoplasmic side of the membrane to the external medium, allowing direct assessment of antiporter activity .

  • Ion transport assays: Cation/proton antiport activity can be measured by monitoring the dissipation of an artificially imposed pH gradient in the presence of specific cations. This approach allows quantification of Na+/H+ and K+/H+ exchange activities under various conditions .

  • pH-dependent activity profiling: To characterize the pH dependence of mnhC2 function within the Mnh2 complex, antiporter activity should be assessed across a range of pH values (typically pH 7.0 to 9.5) .

  • Growth phenotype analysis: The functional significance of mnhC2 can be assessed by comparing growth rates of wild-type, deletion mutant, and complemented strains under various stress conditions (different pH values and salt concentrations) .

The following table summarizes typical experimental conditions for assessing Mnh2 antiporter activity:

ParameterConditions for AssessmentExpected Outcome for Functional Mnh2
pH RangepH 7.0 - 9.5Highest activity at pH 8.5
Na+ Exchange0.2 M - 0.8 M NaClSignificant Na+/H+ antiport activity
K+ ExchangeVarious KCl concentrationsDetectable K+/H+ antiport activity
Growth ConditionsLB with 0.2 M - 0.8 M NaCl, pH 8.5-9.5Restored growth in complemented strains

What experimental designs are most suitable for studying mnhC2 function in vivo?

When designing experiments to study mnhC2 function in vivo, researchers should consider implementing quasi-experimental designs that provide robust evidence for causal relationships. Based on established methodologies, the following approaches are recommended:

  • Gene deletion and complementation: Generate mnhC2 deletion mutants (ΔmnhC2) and complemented strains where the wild-type gene is reintroduced. This approach allows for direct assessment of mnhC2's contribution to antiporter function and phenotypic outcomes .

  • Untreated control group with dependent pretest and posttest samples design: This quasi-experimental design involves comparing intervention and control groups with measurements before and after treatment. For mnhC2 studies, this might involve:

    • Intervention group: O1a X O2a (where X represents mnhC2 deletion or modification)

    • Control group: O1b O2b (wild-type strain)

  • Multiple pretest and posttest observations (interrupted time-series design): This robust design includes multiple measurements before and after intervention:
    O1 O2 O3 O4 O5 X O6 O7 O8 O9 O10
    Where X represents the genetic modification of mnhC2, and O represents measurements of relevant parameters (growth rate, pH homeostasis, cation transport, etc.) .

  • In vivo infection models: Based on established protocols for Mnh1, mouse infection models can be used to assess the contribution of mnhC2 to S. aureus virulence. While Mnh1 deletion significantly reduced virulence, Mnh2 manipulation showed minimal impact on virulence, suggesting different physiological roles .

  • Environmental stress testing: Subject wild-type and mnhC2-modified strains to various environmental stressors (pH shifts, osmotic stress, ionic stress) and monitor survival, growth rates, and physiological parameters to assess the specific contribution of mnhC2 to stress adaptation .

How does the mnhC2 subunit contribute to pH homeostasis and salt tolerance?

The mnhC2 subunit, as part of the Mnh2 antiporter complex, plays a significant role in maintaining pH homeostasis and salt tolerance in S. aureus, particularly under alkaline conditions. Experimental evidence provides several insights into these contributions:

  • pH-dependent function: The Mnh2 complex, including the mnhC2 subunit, exhibits optimal activity at alkaline pH (approximately pH 8.5), suggesting a specialized role in protecting S. aureus from alkaline stress. Deletion of Mnh2 components primarily affects growth at pH values between 8.5 and 9.5 .

  • Cation exchange mechanisms: The mnhC2 subunit contributes to the Mnh2 complex's ability to exchange both Na+ and K+ ions for H+ ions. This activity helps maintain appropriate cytoplasmic pH and ion concentrations under high salt conditions. The dual specificity for Na+ and K+ distinguishes Mnh2 from the more Na+-specific Mnh1 antiporter .

  • Growth under salt stress: Experimental data demonstrates that the Mnh2 antiporter system supports growth in the presence of up to 0.8 M NaCl or 0.4 M LiCl. This halotolerance function is crucial for S. aureus survival in high-salt environments, such as on the human skin or in food preservation conditions .

  • Complementary system: The mnhC2-containing Mnh2 antiporter appears to function complementarily with the Mnh1 system, as evidenced by the finding that double deletion of both systems leads to more severe growth impairment at alkaline pH than either single deletion alone .

What are the unique properties of the Mnh2 antiporter that differentiate it from other antiporter systems?

The Mnh2 antiporter system, which includes the mnhC2 subunit, demonstrates several unique properties that distinguish it from other bacterial antiporter systems:

  • Multisubunit architecture: Unlike single-protein antiporters such as NhaA or NhaB in E. coli (approximately 1.5 kbp in gene length), the Mnh2 system consists of seven hydrophobic membrane-bound protein subunits encoded by approximately 6 kbp of DNA. This complex architecture likely enables sophisticated regulation and ion selectivity .

  • Dual cation specificity: The Mnh2 system exhibits significant exchange activity for both Na+/H+ and K+/H+ at alkaline pH, whereas many bacterial antiporters show more restricted cation specificity .

  • pH-activity profile: Unlike the NhaA-type antiporters of E. coli or V. parahaemolyticus, which show minimal activity at pH 7.0 but high activity at pH 8.5, the Mnh2 system demonstrates measurable activity at neutral pH with enhanced function at alkaline pH .

  • Physiological role: Experimental evidence suggests that while the Mnh1 system significantly impacts virulence in mouse infection models, the Mnh2 system (including mnhC2) does not substantially affect virulence. This indicates specialization for environmental adaptation rather than direct virulence functions .

  • pH optimum: The Mnh2 system functions optimally at pH 8.5, compared to Mnh1's optimal activity at pH 7.5, indicating distinct physiological roles in pH homeostasis .

How does deletion of mnhC2 affect S. aureus growth under various environmental conditions?

While the search results do not specifically address mnhC2 deletion alone, the effects of Mnh2 system disruption provide insights into the likely consequences of mnhC2 deletion:

  • pH-dependent growth effects: Deletion of Mnh2 components primarily affects S. aureus growth at pH values between 8.5 and 9.5, with minimal impact at neutral or acidic pH. This indicates that mnhC2, as part of the Mnh2 complex, is particularly important for alkaline pH tolerance .

  • Salt tolerance: Under elevated salt conditions, disruption of the Mnh2 system would be expected to reduce growth rates at alkaline pH. The Mnh2 complex supports growth in media containing up to 0.8 M NaCl or 0.4 M LiCl, suggesting that mnhC2 deletion would compromise this halotolerance .

  • Combined stress conditions: The most pronounced growth defects would be expected under combined stress conditions involving both elevated salt concentrations and alkaline pH. This reflects the specialized role of the Mnh2 system in managing these combined stressors .

  • Virulence impact: Unlike disruption of the Mnh1 system, Mnh2 deletion does not significantly reduce S. aureus virulence in mouse infection models. This suggests that mnhC2 deletion would have minimal direct impact on pathogenicity .

  • Compensatory mechanisms: The presence of the Mnh1 system may partially compensate for mnhC2 deletion under certain conditions, explaining why double deletion of both Mnh1 and Mnh2 systems results in more severe growth defects than either single deletion alone .

What structural features of mnhC2 determine its ion specificity and transport mechanism?

Understanding the structural determinants of mnhC2 function requires analysis of specific protein domains and amino acid residues that contribute to ion specificity and transport:

  • Transmembrane topology analysis: While specific structural data for mnhC2 is not directly provided in the search results, research on related antiporter subunits suggests that mnhC2 likely contains multiple transmembrane domains that form ion-conducting pathways through the membrane. Computational prediction of transmembrane segments and experimental topology mapping using fusion proteins can help identify these critical structural elements.

  • Conserved residues in ion binding sites: Sequence alignment of mnhC2 with homologous proteins from other species can identify conserved residues that potentially contribute to cation binding and specificity. Site-directed mutagenesis of these residues, followed by functional assays in everted membrane vesicles, can experimentally validate their roles .

  • Subunit interactions: As part of a multisubunit complex, mnhC2 likely engages in specific protein-protein interactions with other Mnh2 components. Techniques such as crosslinking, co-immunoprecipitation, and bacterial two-hybrid assays can identify interaction partners and interfaces that contribute to complex assembly and function.

  • pH-sensing domains: The enhanced activity of the Mnh2 system at alkaline pH suggests the presence of pH-sensing domains. These might involve histidine residues that change protonation state and conformation in response to pH shifts, thereby modulating transport activity .

  • Differential K+ vs. Na+ transport: The ability of the Mnh2 system to transport both Na+ and K+ ions suggests specific structural features that accommodate both cations. Comparative analysis with the more Na+-specific Mnh1 system could reveal key differences in the ion selectivity filter regions .

How do individual subunits of the Mnh2 antiporter system work together for functional transport?

  • Subunit assembly requirements: Experimental evidence indicates that most (approximately 6 kbp) of the DNA encoding the Mnh system is necessary for functional salt tolerance when expressed in antiporter-deficient E. coli. This suggests that multiple subunits, likely including mnhC2, must be correctly assembled for proper antiporter function .

  • Subunit stoichiometry: While the exact stoichiometry of the Mnh2 complex is not specified in the search results, related multisubunit transport systems typically have defined subunit ratios. Determining the stoichiometry through techniques such as Blue Native PAGE combined with quantitative Western blotting would provide insights into complex organization.

  • Sequential assembly process: The assembly of the Mnh2 complex likely follows a defined pathway, with certain subunits forming initial subcomplexes before complete assembly. Pulse-chase experiments combined with co-immunoprecipitation could help elucidate this assembly process.

  • Conformational coupling: The transport mechanism likely involves conformational changes that are transmitted between subunits, including mnhC2, during the transport cycle. Techniques such as double electron-electron resonance (DEER) spectroscopy or fluorescence resonance energy transfer (FRET) could help map these conformational changes in the assembled complex.

  • Functional compensation: Experimental data on the Mnh1 and Mnh2 systems suggests some functional redundancy, as evidenced by the more severe phenotype observed with double deletion compared to single deletions. This indicates potential compensatory mechanisms between similar subunits in different antiporter complexes .

What experimental approaches can resolve contradictions in mnhC2 functional data?

When faced with contradictory experimental results regarding mnhC2 function, researchers should consider implementing the following methodological approaches:

  • Quasi-experimental designs with control groups: Utilize robust experimental designs such as untreated control group designs with dependent pretest and posttest samples. This approach can help distinguish the effects of mnhC2 manipulation from confounding variables .

Experimental DesignStructureAdvantage
Untreated control group with dependent pretest and posttest samplesIntervention group: O1a X O2a
Control group: O1b O2b
Controls for maturation and history effects
Double pretest designIntervention group: O1a O2a X O3a
Control group: O1b O2b O3b
Helps refute regression to the mean
Switching replicationsIntervention group: O1a X O2a O3a
Control group: O1b O2b X O3b
Provides within-group validation
  • Multiple methodological approaches: When contradictory results arise, employing multiple independent methods to assess mnhC2 function can provide converging evidence. For example, combining genetic deletion studies, biochemical transport assays with everted vesicles, and growth phenotype analyses under various conditions .

  • Time-series analysis: Implementing interrupted time-series designs with multiple measurements before and after intervention (O1 O2 O3 O4 O5 X O6 O7 O8 O9 O10) can help distinguish true intervention effects from random fluctuations or regression to the mean .

  • Eliminated alternative hypotheses: Systematically testing alternative explanations for observed phenomena can help resolve contradictions. For example, if unexpected results occur after mnhC2 manipulation, examining potential compensatory upregulation of other antiporter systems could explain apparent contradictions .

  • Strain background considerations: Differences in the genetic background of S. aureus strains used in experiments can lead to contradictory results. Using isogenic strains with well-defined genetic backgrounds and complementation studies can help resolve such contradictions .

What is the relationship between mnhC2 function and S. aureus virulence in different infection models?

The relationship between mnhC2 function and S. aureus virulence appears to be minimal based on available experimental evidence, although this contrasts with the significant impact of the Mnh1 system on virulence:

  • Mouse infection model findings: Experimental data indicates that while deletion of the mnhA1 gene (Mnh1 system) led to a major loss of S. aureus virulence in mice, deletion of mnh2 components resulted in no significant change in virulence. This suggests that the Mnh2 system, including mnhC2, does not play a critical role in directly supporting virulence in these models .

  • Physiological vs. pathogenic roles: The Mnh2 system appears to be more specialized for environmental adaptation, particularly for growth under alkaline and high-salt conditions, rather than directly contributing to virulence mechanisms. This functional specialization likely explains its minimal impact on pathogenesis in standard infection models .

  • Tissue-specific relevance: Despite the limited impact in general virulence models, the Mnh2 system might have tissue-specific relevance in environments characterized by alkaline pH and elevated salt concentrations. Researchers should consider specialized infection models that mimic these specific conditions to fully evaluate mnhC2's potential contribution to niche-specific pathogenesis.

  • Compensatory mechanisms: The presence of functional redundancy between different antiporter systems may mask the contribution of mnhC2 to virulence in some experimental settings. Simultaneous disruption of multiple antiporter systems might reveal synergistic effects on virulence that are not apparent with single-system manipulations .

How can mnhC2 be targeted for potential antimicrobial development?

The potential for targeting mnhC2 and the Mnh2 antiporter system for antimicrobial development presents several research directions:

  • Target validation considerations: While the Mnh2 system (including mnhC2) does not appear to significantly impact virulence in standard mouse models, its importance for growth under specific environmental conditions suggests potential as an antimicrobial target in certain infection contexts. The most promising approach would be combined targeting of both Mnh1 and Mnh2 systems, as double deletion produces more severe growth defects than either single deletion .

  • Structure-based inhibitor design: Determination of the three-dimensional structure of mnhC2 through X-ray crystallography or cryo-electron microscopy would facilitate structure-based design of specific inhibitors that disrupt antiporter function. Focus should be placed on regions involved in subunit interactions or ion binding.

  • High-throughput screening approaches: Development of functional assays suitable for high-throughput screening, such as fluorescence-based ion transport assays in proteoliposomes or whole-cell growth inhibition assays under high-salt alkaline conditions, could identify lead compounds that specifically target the Mnh2 system.

  • Peptide inhibitors: Based on the multisubunit nature of the Mnh2 complex, designing peptides that mimic interaction interfaces between mnhC2 and other subunits could disrupt complex assembly and function. These interaction-disrupting peptides could serve as leads for peptidomimetic drug development.

  • Combination therapies: Given the potential for functional compensation between different antiporter systems, combination approaches targeting both Mnh1 and Mnh2 systems simultaneously would likely show enhanced efficacy compared to selective Mnh2 targeting .

What biotechnological applications could exploit the unique properties of mnhC2?

The unique properties of mnhC2 as part of the Mnh2 antiporter system offer several potential biotechnological applications:

  • Engineered salt tolerance in industrial microorganisms: Expression of the Mnh2 system, including mnhC2, in industrial production strains could enhance their tolerance to high-salt conditions and alkaline pH, potentially improving performance in industrial bioprocesses. The demonstrated ability to confer salt tolerance when expressed in E. coli suggests transferability to other bacterial systems .

  • Biosensors for environmental monitoring: The pH-dependent and cation-specific activity of the Mnh2 system could be exploited to develop whole-cell biosensors for monitoring environmental parameters such as pH shifts or specific cation concentrations in industrial or natural settings.

  • Protein engineering platforms: The multisubunit nature of the Mnh2 complex provides opportunities for protein engineering to create modified transporters with novel ion specificities or regulatory properties. Such engineered transporters could have applications in synthetic biology and metabolic engineering.

  • Membrane protein research tools: The successful expression and functional reconstitution of the Mnh2 complex in heterologous systems provides a valuable model system for studying the assembly and function of complex membrane protein systems, potentially informing broader membrane protein research .

  • Biofilm control strategies: Given the importance of pH homeostasis and ion transport for biofilm formation in S. aureus, manipulation of Mnh2 function through specific inhibitors or activators could potentially modulate biofilm development in both clinical and industrial contexts.

What are common challenges in expressing and purifying functional recombinant mnhC2?

Researchers working with recombinant mnhC2 are likely to encounter several technical challenges throughout the expression and purification process:

  • Expression system selection: Due to the integral membrane nature of mnhC2, selection of an appropriate expression system is critical. While E. coli systems have been successfully used for functional expression of Mnh complexes, researchers should consider the following optimizations:

    • Use of specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3))

    • Tunable promoter systems to prevent toxic overexpression

    • Fusion tags that enhance membrane targeting and insertion

  • Multisubunit complex assembly: As mnhC2 functions as part of a seven-subunit complex, expressing it in isolation may result in improper folding or instability. Co-expression strategies involving multiple Mnh2 subunits may be necessary to achieve proper assembly and function. Polycistronic expression constructs or multiple compatible plasmids can facilitate this approach .

  • Detergent selection for extraction: Membrane protein solubilization requires careful selection of detergents that maintain native structure and function. Initial screening with a panel of detergents (e.g., DDM, LMNG, CHAPSO) is advisable, followed by functional assessment of the solubilized protein.

  • Purification strategy optimization: Affinity tags should be positioned to avoid interference with functional domains or subunit interactions. Tandem affinity purification approaches may improve purity while maintaining gentle conditions that preserve complex integrity.

  • Functional verification methods: Unlike soluble proteins, assessment of proper folding for membrane proteins like mnhC2 can be challenging. Researchers should establish functional assays early in the purification process to monitor activity retention, such as reconstitution into proteoliposomes followed by ion transport assays .

How can researchers address inconsistent results in mnhC2 functional assays?

When faced with inconsistent results in mnhC2 functional assays, researchers should systematically evaluate and address potential sources of variability:

  • Standardize membrane vesicle preparation: Inconsistencies in everted membrane vesicle preparation can significantly impact antiporter activity measurements. Key standardization points include:

    • Consistent growth conditions for cells prior to vesicle preparation

    • Standardized buffer compositions and pH control

    • Verification of vesicle orientation using established markers

    • Consistent protein-to-lipid ratios in reconstituted systems

  • Implement quasi-experimental designs: Utilize robust experimental designs such as those with multiple pretests or time-series measurements to distinguish true effects from random variations or measurement artifacts . The table below illustrates appropriate design selections:

IssueRecommended DesignNotation
Suspected regression to meanDouble pretest designO1 O2 X O3
Environmental fluctuationsMultiple measurement time seriesO1 O2 O3 O4 O5 X O6 O7 O8 O9 O10
Control group comparabilitySwitching replicationsIntervention: O1a X O2a O3a
Control: O1b O2b X O3b
  • Control environmental variables: Antiporter activity is highly sensitive to pH, temperature, and ionic conditions. Implement stringent control of these parameters, including:

    • pH measurement before and after assays

    • Temperature control during measurements

    • Ion composition verification in all buffers

  • Verify protein expression levels: Variations in mnhC2 expression levels between experiments can lead to inconsistent results. Implement quantitative Western blotting to normalize activity measurements to actual protein levels.

  • Consider genetic background effects: When working with different S. aureus strains, genetic variations might influence mnhC2 function. When possible, perform experiments in isogenic backgrounds and include appropriate complementation controls .

What controls and validation steps are essential for mnhC2 research?

Robust mnhC2 research requires implementation of several critical controls and validation steps:

  • Genetic controls:

    • Wild-type strain to establish baseline phenotypes

    • Clean deletion mutant (ΔmnhC2) constructed using scarless methods

    • Complemented strain expressing mnhC2 from a controlled promoter

    • Double mutants lacking both Mnh1 and Mnh2 components to assess functional redundancy

  • Biochemical assay controls:

    • Positive control using a well-characterized antiporter system

    • Negative control using vesicles from cells lacking antiporter activity

    • Ion specificity controls using various cations (Na+, K+, Li+) to verify specificity

    • pH range controls to establish pH-activity profiles

  • Expression validation:

    • mRNA quantification using RT-qPCR to verify transcription

    • Protein detection using specific antibodies or epitope tags

    • Membrane localization verification using fractionation and Western blotting

    • Functional complementation in antiporter-deficient strains

  • Phenotypic validation:

    • Growth curves under various stress conditions (pH, salt concentration)

    • Comparison of multiple independent mutant clones to rule out secondary mutations

    • In vivo virulence assessment in appropriate animal models

  • Statistical validation:

    • Appropriate sample sizes based on power calculations

    • Replication across multiple independent experiments

    • Application of appropriate statistical tests for data analysis

    • Implementation of quasi-experimental designs that control for confounding variables

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.