Recombinant Staphylococcus aureus Putative antiporter subunit mnhE2 (mnhE2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Staphylococcus aureus Putative Antiporter Subunit MnhE2 (MnhE2)

Staphylococcus aureus is a Gram-positive bacterium that can act as both a commensal and an opportunistic pathogen, causing a range of infections from minor skin conditions to life-threatening diseases . To survive under various environmental stresses, S. aureus utilizes cation/proton antiporters to maintain cytoplasmic pH . MnhE2 is a subunit of the multisubunit Na+/H+ antiporters Mnh1 and Mnh2, which are part of the type 3 cation/proton antiporter family . These antiporters are crucial for the bacterium's survival in extreme conditions by maintaining cytoplasmic pH .

Characteristics of MnhE2

MnhE2 is a putative antiporter subunit found in Staphylococcus aureus . It is encoded by the mnhE2 gene and is a component of the Mnh2 antiporter complex . Mnh2 shows a significant exchange of both Na+/H+ and K+/H+ cations, especially at pH 8.5 . The mnh2 operon, which includes mnhE2, is induced by σB, a general stress transcription factor, indicating its role in stress response .

Table 1: Key Features of Recombinant Staphylococcus aureus Putative Antiporter Subunit mnhE2

FeatureDescription
Alternative NamesMrp complex subunit E2, Putative NADH-ubiquinone oxidoreductase subunit mnhE2
SourceE. coli, Yeast, Baculovirus, or Mammalian Cell
Purity>85% (SDS-PAGE)
UniProt No.Q2G210
StorageLiquid form: 6 months at -20°C/-80°C; Lyophilized form: 12 months at -20°C/-80°C
Tag InfoDetermined during manufacturing process
FunctionContributes to Na+/H+ and K+/H+ antiport activity, playing a role in osmotolerance and halotolerance

Role of MnhE2 in Staphylococcus aureus Physiology

  1. Antiporter Activity: Mnh2, which includes the MnhE2 subunit, catalyzes Na+/H+ and K+/H+ antiport activity, particularly at higher pH levels . This activity is crucial for maintaining cytoplasmic pH under alkaline conditions and high salt concentrations.

  2. Stress Response: The mnh2 operon is induced by σB, suggesting that MnhE2 and the Mnh2 complex are important for the bacterium's response to environmental stresses .

  3. Osmotolerance and Halotolerance: Mnh2 contributes to both osmotolerance and halotolerance in S. aureus, enabling the bacterium to survive in environments with high osmotic and salt concentrations . Mnh2 exhibits Na+/H+antiport activity comparable to that of Mnh1 at pH 7.5 when sufficient [Na+] is provided . Cytoplasmic concentrations of K+ in the range of 900 mM are found in S. aureus .

Research Findings and Significance

  1. Catalytic Properties: Studies have shown that Mnh2 exhibits significant Na+/H+ and K+/H+ exchange, especially at pH 8.5, highlighting its role in maintaining pH homeostasis .

  2. Genetic Studies: Deletion of the mnhA2 gene, which encodes a subunit of the Mnh2 complex, leads to a reduction in the growth rate of S. aureus under elevated salt conditions, particularly in the pH range of 8.5 to 9.5 .

  3. Virulence: While deletion of mnhA1 leads to a major loss of S. aureus virulence in mice, deletion of mnhA2 does not significantly alter virulence . This suggests that Mnh1 plays a more critical role in virulence than Mnh2.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mnhE2; mrpE2; SaurJH9_0649; Putative antiporter subunit mnhE2; Mrp complex subunit E2; Putative NADH-ubiquinone oxidoreductase subunit mnhE2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Staphylococcus aureus (strain JH9)
Target Names
mnhE2
Target Protein Sequence
MNQIVLNIIIAFLWVLFQDEDHFKFSTFFSGYLIGLIVIYILHRFFSDDFYVRKIWVAIK FLGVYLYQLITSSISTINYILFKTKDMNPGLLSYETRLTSDWAITFLTILIIITPGSTVI RISQDSKKFFIHSIDVSEKEKDSLLRSIKHYEDLILEVSR
Uniprot No.

Target Background

Database Links
Protein Families
CPA3 antiporters (TC 2.A.63) subunit E family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MnhE2 and what is its role in Staphylococcus aureus?

MnhE2 is one of the seven hydrophobic membrane-bound protein subunits comprising the Mnh2 cation/proton antiporter complex in Staphylococcus aureus. It functions as part of the multisubunit Na+/H+ and K+/H+ antiporter system (Mnh2) that plays crucial roles in maintaining cytoplasmic pH and enabling bacterial survival under extreme environmental stress conditions. The Mnh2 antiporter complex, which includes MnhE2, demonstrates significant exchange activities for both Na+/H+ and K+/H+ cations, with optimal activity at pH 8.5. This complex is particularly important for S. aureus osmotolerance and halotolerance .

How does MnhE2 differ from subunits in the Mnh1 antiporter complex?

While both Mnh1 and Mnh2 complexes in S. aureus function as cation/proton antiporters, their constituent subunits (including MnhE1 and MnhE2) demonstrate distinct functional properties and expression patterns. The Mnh1 antiporter, of which MnhE1 is a component, primarily exhibits Na+/H+ exchange activity with optimal function at pH 7.5. In contrast, the Mnh2 complex containing MnhE2 shows significant exchange activities for both Na+/H+ and K+/H+ ions, with optimal activity at pH 8.5. Furthermore, expression of Mnh1 (including MnhE1) is largely constitutive, while Mnh2 (including MnhE2) expression is induced by the sigma factor σB .

What is the genetic organization of mnh2 in the S. aureus genome?

The mnh2 operon, which includes the mnhE2 gene, is transcribed in a different direction from mnh1 in the S. aureus chromosome. The mnh2 operon is preceded by an integrase-recombinase gene (itr) followed by the seven mnh2 genes. This contrasts with the mnh1 operon, which consists solely of the seven mnh1 genes. This distinct genetic organization suggests differential regulation and potentially specialized functions for the Mnh2 complex in S. aureus physiology .

What methodologies can be used to clone and express recombinant MnhE2 for functional studies?

For cloning and expression of recombinant MnhE2, researchers should consider the following methodological approach:

  • Gene Amplification: PCR-amplify the mnhE2 gene from S. aureus genomic DNA using high-fidelity DNA polymerase and specific primers designed with appropriate restriction sites.

  • Vector Selection and Cloning: Clone the gene into an expression vector such as pGEM3Z+ (used successfully for other Mnh components) for antiporter-deficient E. coli systems, or into vectors with His-tags for easier purification.

  • Expression System: Transform the construct into an appropriate E. coli host strain, preferably an antiporter-deficient strain like KNabc E. coli for complementation studies.

  • Protein Expression and Purification: Induce protein expression using IPTG or other suitable inducers, followed by cell lysis and protein purification. For membrane proteins like MnhE2, detergent solubilization is typically required.

  • Quality Control: Confirm protein purity using SDS-PAGE and HPLC, determine protein concentration using the BCA method, and ensure endotoxin levels are below 2.5 pg/μg using a Tachypleus Amebocyte Lysate assay .

How can the functional activity of recombinant MnhE2 be assessed in vitro?

The functional activity of recombinant MnhE2, as part of the Mnh2 complex, can be assessed using the following methodological approaches:

  • Everted Vesicle Preparation: Prepare everted (inside-out) membrane vesicles from E. coli cells expressing the complete Mnh2 complex or reconstituted systems containing purified MnhE2.

  • Antiporter Activity Assay: Measure cation/proton antiport activity by monitoring the dissipation of an artificially imposed pH gradient in response to added cations (Na+ or K+). This can be done using pH-sensitive fluorescent probes.

  • pH Dependence Characterization: Test antiporter activity across a range of pH values (particularly at pH 8.5 where Mnh2 shows optimal activity) to determine the pH profile of the antiporter function.

  • Cation Specificity Assessment: Compare antiporter activity with different cations (Na+, K+, Li+, etc.) at various concentrations to determine substrate specificity and affinity.

  • Energization Methods: Assess antiporter activity using different energization methods, such as succinate oxidation or ATP hydrolysis, to establish the PMF-dependence of the antiport mechanism .

What strategies can be employed to create mnhE2 deletion mutants in S. aureus?

To create mnhE2 deletion mutants in S. aureus, researchers can employ the following strategic approach:

  • Allelic Replacement: Design constructs containing upstream and downstream regions of mnhE2 flanking a selectable marker (e.g., antibiotic resistance cassette).

  • Vector Selection: Clone these constructs into temperature-sensitive shuttle vectors suitable for S. aureus transformation.

  • Transformation: Transform the constructs into S. aureus strains like SH1000 or Newman, which have been successfully used for mnhA deletions.

  • Selection Process:

    • Integrate the plasmid at permissive temperature with selection

    • Promote excision of the plasmid at non-permissive temperature

    • Screen for mutants that have lost the plasmid but retained the resistance marker

  • Verification: Confirm deletions using PCR, Southern blotting, and RT-PCR to verify the absence of targeted gene expression.

  • Complementation: Create complementation strains by reintroducing the wild-type gene to confirm phenotypes are directly attributable to mnhE2 deletion .

What phenotypic changes should be monitored when assessing mnhE2 mutants?

When assessing mnhE2 mutants, researchers should monitor the following phenotypic parameters:

  • Growth Characteristics:

    • Growth rates at different pH values, particularly at pH 8.5-9.5 where Mnh2 function is most critical

    • Colony morphology and pigmentation (previous studies showed hyperpigmentation in mnhA1 mutants)

    • Growth under varying salt concentrations to assess halotolerance

  • pH Homeostasis:

    • Internal pH measurements under various external pH conditions

    • Response to sudden alkalinization or acidification challenges

  • Cation Sensitivity:

    • Growth in media with elevated Na+ or K+ concentrations

    • Minimum inhibitory concentrations of various cations

  • Virulence Characteristics:

    • Biofilm formation capacity

    • Expression of virulence factors

    • Survival in infection models

  • Stress Responses:

    • Osmotic stress tolerance

    • Oxidative stress resistance

    • Response to antimicrobial peptides

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.