Recombinant Staphylococcus aureus Riboflavin transporter RibU (ribU)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

RibU is heterologously expressed in E. coli or yeast systems for structural and functional studies. Key production parameters include:

  • Expression Systems:

    • E. coli: Full-length protein (1–189 aa) with N-terminal His-tag .

    • Yeast: Partial-length constructs for functional assays .

  • Purity: >85% via SDS-PAGE .

  • Storage: Lyophilized form stable for 12 months at -20°C/-80°C .

Table 2: Recombinant RibU Production Parameters

ParameterE. coli SystemYeast System
Expression RegionFull-length (1–189 aa)Partial (e.g., L1 loop)
TagN-terminal 10xHis-tagVaries (unspecified)
Purity>85% (SDS-PAGE)>85% (SDS-PAGE)
Storage-20°C/-80°C (lyophilized)-20°C/-80°C (lyophilized)

Binding and Transport Mechanism

  • Spectroscopic Evidence: Riboflavin binding induces absorbance shifts (441, 464, 486 nm) and fluorescence quenching, confirming hydrophobic pocket interactions .

  • Mutagenesis: Trp-68 substitution abolishes riboflavin binding, highlighting its critical role .

  • Comparative Analysis:

    • ECF vs. ABC Transporters: RibU (ECF) exhibits higher affinity (Kd=0.6nMK_d = 0.6 \, \text{nM}) than ABC-type RfuA (KdμMK_d \sim \mu\text{M}) .

    • Energy Dependency: Requires ATP hydrolysis, unlike passive transporters like RibM (Corynebacterium) .

Table 3: RibU vs. Other Riboflavin Transporters

FeatureRibU (ECF, S. aureus)RibM (Facilitator, C. glutamicum)RfuA (ABC, T. pallidum)
Affinity (KdK_d)0.6 nM11 μM~10 nM (estimated)
Energy RequirementATP-dependentEnergy-independentATP-dependent
Substrate SpecificityRiboflavin, FMN, roseoflavinRiboflavinRiboflavin

Metabolic Engineering

  • Riboflavin Production: Overexpression in Bacillus subtilis enhances riboflavin biosynthesis by optimizing substrate uptake .

  • Roseoflavin Sensitivity: Recombinant RibU increases roseoflavin toxicity in B. subtilis, aiding strain optimization .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ribU; HMPREF0772_11721; Riboflavin transporter RibU; Riboflavin ECF transporter S component RibU
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Staphylococcus aureus (strain TCH60)
Target Names
ribU
Target Protein Sequence
MNGRRKLNMQQNKRLITISMLSAIAFVLTFIKFPIPFLPPYLTLDFSDVPSLLATFTFGP VAGIIVALVKNLLNYLFSMGDPVGPFANFLAGASFLLTAYAIYKNKRSTKSLITGLIIAT IVMTIVLSILNYFVLLPLYGMIFNLADIANNLKVIIVSGIIPFNIIKGIVISIVFILLYR RLANFLKRI
Uniprot No.

Target Background

Function
RibU, the recombinant Staphylococcus aureus Riboflavin transporter, mediates riboflavin uptake and may also transport FMN and roseoflavin. It is likely a riboflavin-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporter complex. Unlike traditional ABC transporters, this ECF transporter provides the energy required to transport a variety of substrates. These substrates are bound by transmembrane proteins, not extracytoplasmic soluble proteins.
Database Links
Protein Families
Prokaryotic riboflavin transporter (P-RFT) (TC 2.A.87) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structural characterization of the S. aureus RibU transporter?

RibU in bacterial species is typically characterized as a membrane transport protein containing five membrane-spanning segments. It belongs to a novel transport protein family not previously described in the Transport Classification Database. While specific S. aureus RibU structural data is limited in the available literature, research on homologous proteins in Lactococcus lactis indicates these are specialized transporters involved in riboflavin uptake across the cell membrane . Researchers working with S. aureus RibU should expect similar structural features, though species-specific variations in membrane topology may exist.

How is ribU gene expression regulated in bacterial systems?

Transcriptional analysis has revealed that ribU expression is typically downregulated in response to riboflavin and flavin mononucleotide (FMN). This regulation occurs through a structurally conserved RFN (riboflavin) element located between the transcription start site and the start codon . In bacterial mutants carrying a defective ribU gene, altered transcriptional control of the riboflavin biosynthesis operon (ribGBAH) has been observed in response to riboflavin and FMN. This regulatory mechanism ensures bacteria can modulate riboflavin uptake based on environmental availability, representing an important adaptive response .

What experimental evidence confirms RibU's function as a riboflavin transporter?

Direct evidence for RibU's role in riboflavin transport comes from radiolabeled riboflavin uptake assays. Research has demonstrated that bacterial strains with mutated ribU genes fail to take up radiolabeled riboflavin, while wild-type strains successfully transport the vitamin across the membrane . Additionally, these mutant strains do not consume riboflavin from their growth medium, further confirming RibU's essential role in riboflavin acquisition. Competitive inhibition studies with FMN and the toxic riboflavin analogue roseoflavin have shown these compounds inhibit riboflavin uptake, suggesting they are also RibU substrates .

What are the optimal expression systems for producing recombinant S. aureus RibU?

For recombinant expression of membrane proteins like RibU, E. coli-based expression systems remain the standard approach, though specific optimization is necessary. When working with S. aureus RibU, researchers should consider using the pET expression system with BL21(DE3) strains, incorporating a hexahistidine tag for purification. Critical parameters include induction temperature (typically reduced to 16-20°C), IPTG concentration (0.1-0.5 mM), and expression duration (4-16 hours). For membrane proteins like RibU, detergent screening (including DDM, LDAO, and MNG derivatives) is essential for extraction and maintaining protein stability during purification .

How can researchers effectively study the transport kinetics of RibU in membrane systems?

To study RibU transport kinetics, researchers should implement either radioisotope-based uptake assays or fluorescence-based approaches. For radioisotope methods, [³H]-riboflavin or [¹⁴C]-riboflavin can be used with rapid filtration techniques to measure transport rates in either intact cells or reconstituted proteoliposomes. For fluorescence-based approaches, riboflavin's intrinsic fluorescence provides a convenient signal for real-time transport studies . Key experimental parameters that must be controlled include:

ParameterRecommended RangeConsiderations
pH6.5-7.5Transport activity typically optimal near neutral pH
Temperature25-37°CHigher temperatures increase rate but may reduce stability
Riboflavin concentration0.1-100 μMShould span range around Km for kinetic studies
Time points5s-30minEarly timepoints critical for initial rate determination

Proteoliposome reconstitution with purified RibU represents the gold standard for determining intrinsic transport properties without interference from other cellular components .

What approaches can be used to characterize RibU's substrate specificity?

Determining RibU's substrate specificity requires multiple complementary approaches. Competition assays using radiolabeled riboflavin uptake in the presence of potential substrates provide initial insights into binding affinity. Research has shown that both FMN and roseoflavin (a toxic riboflavin analogue) can inhibit riboflavin uptake through RibU . For more detailed binding studies, isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) with purified RibU can provide direct binding constants. Researchers should also consider computational approaches, including homology modeling and molecular docking, to identify potential substrate binding pockets and interaction sites that can guide subsequent mutagenesis studies of the binding domain .

How does riboflavin transport via RibU contribute to S. aureus virulence and host adaptation?

The relationship between riboflavin acquisition and S. aureus virulence represents a complex and emerging research area. While direct evidence linking RibU to S. aureus pathogenicity is still developing, research on bacterial adaptation suggests nutritional acquisition systems are critical virulence determinants . Riboflavin is an essential precursor for flavin adenine dinucleotide (FAD) and flavin mononucleotide (FMN), which serve as cofactors in numerous metabolic processes, including cellular respiration and oxidative stress response. In infection contexts, where nutrient availability is restricted by host sequestration mechanisms, efficient riboflavin transport may provide a significant competitive advantage .

Researchers investigating this connection should consider infection models where riboflavin availability is manipulated, coupled with comparative virulence studies between wild-type and ribU mutant strains. The potential regulation of ribU by the alternative sigma factor σB, which modulates numerous virulence genes in S. aureus, presents another important research direction, given that σB has been shown to control at least 251 genes, with 198 positively controlled and 53 repressed in its presence .

What role does RibU play in S. aureus genetic recombination and adaptation to different host environments?

Large-scale recombination events have been identified as significant drivers of S. aureus evolution and adaptation to different hosts . These events can affect regions spanning the origin of replication and result in allele replacement and functional remodeling of genes involved in host-pathogen interactions. While direct evidence linking RibU to these recombination events is not established in the current literature, transport proteins like RibU that influence metabolic capabilities could theoretically impact bacterial fitness in different niches .

Advanced research in this area should explore whether riboflavin transport capacity varies among S. aureus lineages adapted to different hosts, and whether such variations correlate with recombination signatures in the genome. Comparative genomic approaches examining ribU sequence conservation and variation across host-adapted lineages, coupled with functional characterization of these variants, could provide valuable insights into selection pressures acting on riboflavin acquisition systems .

How does RibU interact with the S. aureus σB regulon and other virulence regulatory networks?

The σB regulon in S. aureus controls approximately 251 genes, including many virulence factors . Investigating whether ribU expression is modulated by σB represents an important research direction. The σB factor appears to upregulate adhesins while repressing various exoproteins and toxins, suggesting it modulates virulence gene expression in a manner that may be contrary to RNAIII, the effector molecule of the agr locus .

For researchers investigating this relationship, transcriptomic studies comparing ribU expression between wild-type and σB-deficient mutants under various environmental conditions (oxidative stress, nutrient limitation, antimicrobial exposure) would be valuable. Chromatin immunoprecipitation approaches could also determine whether σB directly binds to ribU promoter regions. Additionally, examining the impact of ribU mutation on the broader transcriptional landscape would help position this transporter within the complex regulatory networks governing S. aureus virulence .

What are the difficulties in developing inhibitors against RibU as potential antimicrobial agents?

Developing specific inhibitors against bacterial transport proteins like RibU presents several challenges. The membrane-embedded nature of RibU makes structural characterization difficult, limiting structure-based drug design approaches. Additionally, the substrate binding pocket must be sufficiently distinct from human riboflavin transporters to ensure selectivity .

The research approach should involve:

  • Detailed structural characterization using cryo-electron microscopy or X-ray crystallography, potentially using nanobodies or antibody fragments to stabilize the protein

  • Fragment-based screening to identify initial binding molecules

  • Competition assays using roseoflavin derivatives as starting compounds, given roseoflavin's known interaction with RibU

  • Assessment of identified inhibitors for bactericidal activity, particularly against antibiotic-resistant S. aureus strains such as MRSA

How can researchers address the technical challenges in studying membrane protein dynamics of RibU?

Membrane protein dynamics present significant technical challenges. For RibU research, advanced biophysical methods can provide crucial insights into conformational changes during substrate transport. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions of RibU that undergo structural rearrangements upon substrate binding. Single-molecule Förster resonance energy transfer (smFRET) approaches, where strategically placed fluorophores monitor distance changes during the transport cycle, can resolve distinct conformational states .

What new methodologies could advance our understanding of RibU's role in bacterial communities and microbiome contexts?

Understanding RibU's role in complex bacterial communities requires methodological innovations beyond traditional single-species approaches. Researchers should consider implementing:

  • Single-cell tracking technologies with fluorescent riboflavin analogs to visualize uptake heterogeneity within bacterial populations

  • Dual-species competition assays between wild-type and ribU mutant strains to assess fitness advantages under riboflavin-limited conditions

  • Metatranscriptomic analyses of riboflavin transporter expression in microbiome samples to assess ecological relevance

  • CRISPR interference systems for conditional knockdown of ribU in complex communities

  • Stable isotope probing with labeled riboflavin to track metabolic utilization pathways in mixed communities

These approaches would help translate molecular findings to more relevant ecological and clinical contexts, particularly in understanding how riboflavin acquisition systems influence bacterial competition and persistence during colonization and infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.