Recombinant Staphylococcus aureus Sensor protein kinase walK (walK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for users.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
walK; SaurJH9_0019; Sensor protein kinase WalK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-608
Protein Length
full length protein
Species
Staphylococcus aureus (strain JH9)
Target Names
walK
Target Protein Sequence
MKWLKQLQSLHTKLVIVYVLLIIIGMQIIGLYFTNNLEKELLDNFKKNITQYAKQLEISI EKVYDEKGSVNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDS SVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQLNNI NQIFIVGTAISLLITVILGFFIARTITKPITDMRNQTVEMSRGNYTQRVKIYGNDEIGEL ALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAK EDIIGYYMLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIARVNFSTIVQETGFVTGYI AVLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTR EETERMIRLVNDLLQLSKMDNESDQINKEIIDFNMFINKIINRHEMSAKDTTFIRDIPKK TIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQNPLYNRMTIRIKDNGIGIPINK VDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEGQGTSIFITLPCEV IEDGDWDE
Uniprot No.

Target Background

Function

WalK is a member of the two-component WalK/WalR regulatory system in Staphylococcus aureus. This system controls genes involved in cell wall metabolism, virulence, biofilm formation, oxidative stress resistance, and antibiotic resistance, either directly or indirectly through the regulation of autolysins. WalK functions as a sensor histidine kinase, autophosphorylating at a histidine residue within its dimerization domain. Subsequently, it transfers this phosphate group to a conserved aspartic acid residue in the regulatory domain of WalR. WalR then binds to upstream promoter regions of target genes, modulating their expression both positively and negatively.

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the WalKR two-component system in Staphylococcus aureus and why is it significant?

The WalKR system is an essential two-component regulatory system in S. aureus that plays a crucial role in controlling cell wall metabolism, autolysis, biofilm formation, and virulence . It consists of the sensor histidine kinase WalK and its cognate response regulator WalR. This system is highly conserved among low G+C Gram-positive bacteria and is critical for bacterial survival . The significance of WalKR lies in its central role in controlling cellular processes and its association with antimicrobial resistance, particularly to vancomycin and daptomycin . Mutations in this locus have been shown to dramatically affect bacterial behavior, drug resistance profiles, and virulence potential .

What domains are present in the WalK protein and what are their functions?

The WalK protein contains several functional domains that contribute to its sensing and signaling capabilities:

  • Extracellular and intracellular PAS domains: These domains are involved in sensing environmental signals .

  • Histidine kinase domain: This domain is responsible for the autokinase activity, where ATP is used to autophosphorylate a conserved histidine residue .

  • C-terminal tail (CTT): This region contains a W-acidic motif that is essential for interaction with WalR and subsequent signaling .

The different domains work together to facilitate signal transduction from environmental cues to intracellular responses through phosphorylation cascades that ultimately regulate gene expression.

How does the WalKR system control gene expression in S. aureus?

WalKR regulates gene expression through a phosphorelay mechanism:

  • WalK senses specific environmental signals through its sensing domains.

  • Upon signal detection, WalK undergoes autophosphorylation at a conserved histidine residue using ATP .

  • The phosphoryl group is then transferred from WalK to an aspartate residue in WalR (phosphotransferase activity) .

  • Phosphorylated WalR binds to specific DNA sequences to regulate the expression of target genes involved in cell wall metabolism and other cellular processes .

  • WalK also possesses phosphatase activity that can dephosphorylate WalR, allowing for precise temporal control of the signaling pathway .

This regulatory system allows S. aureus to respond appropriately to environmental changes by modulating the expression of genes required for adaptation.

How do mutations in walK contribute to vancomycin and daptomycin resistance in S. aureus?

Mutations in walK play a significant role in the development of intermediate vancomycin resistance (VISA) and cross-resistance to daptomycin in S. aureus:

  • Single nucleotide polymorphisms (SNPs) in walK have been frequently observed in clinical VISA strains and in resistant strains selected in vitro .

  • These mutations alter WalK function, leading to changes in cell wall metabolism, which results in cell wall thickening and reduced autolytic activity - both characteristic features of VISA strains .

  • In experimental studies, introduction of a single walK mutation from a VISA strain into a vancomycin-susceptible S. aureus (VSSA) strain was sufficient to increase both vancomycin and daptomycin MICs, sometimes generating full daptomycin non-susceptibility .

  • Conversely, replacing the mutated walK in a VISA strain with the wild-type allele from a susceptible strain restored vancomycin susceptibility .

These findings indicate that walK mutations serve as a common mechanism for the in vivo evolution of multi-drug resistance in S. aureus, particularly during vancomycin treatment failure .

What phenotypic changes are associated with walK mutations in resistant S. aureus strains?

WalK mutations in resistant S. aureus strains are associated with several phenotypic changes:

  • Increased cell wall thickness: Electron microscopy studies have shown significantly thicker cell walls in strains with walK mutations, contributing to reduced vancomycin penetration and efficacy .

  • Reduced autolytic activity: Strains with walK mutations display decreased autolysis, which affects cell wall turnover and remodeling .

  • Decreased biofilm formation: WalKR regulates biofilm formation, and mutations in this system typically lead to reduced biofilm-forming capacity .

  • Attenuated virulence: WalKR mutations often result in decreased virulence potential, suggesting a trade-off between antimicrobial resistance and pathogenicity .

  • Altered metabolism: Transcriptional changes indicate that walKR mutations impact central metabolism in addition to cell wall processes .

These phenotypic changes collectively contribute to the VISA phenotype and highlight the pleiotropic effects of walKR mutations on S. aureus physiology.

What techniques are used to study WalK-WalR interactions and phosphorylation activities?

Several experimental approaches are employed to study WalK-WalR interactions and phosphorylation activities:

  • Isothermal Titration Calorimetry (ITC): This technique measures the binding affinity between WalK and WalR proteins. For example, wild-type S. mutans WalK (196-450) has been shown to bind full-length WalR with a Kd of 1.21 μM .

  • Phosphorylation assays:

    • ATPγS-based protocols to analyze WalK autophosphorylation, where phosphorylation states are detected using anti-thiophosphate antibodies .

    • Phosphotransferase activity assessment by measuring the reduction of phosphorylated WalK after mixing with WalR .

    • Phosphatase activity evaluation using Phos-tag gels to separate phosphorylated from dephosphorylated WalR .

  • Mutational analysis: Site-directed mutagenesis of key residues (e.g., W443, D441) followed by functional assays to determine their roles in WalK-WalR interactions and enzymatic activities .

  • Allelic exchange experiments: Bi-directional swapping of walK and walR alleles between susceptible and resistant strains to confirm the contribution of specific mutations to antibiotic resistance phenotypes .

These techniques provide complementary information about the molecular mechanisms underlying WalK-WalR signaling and function.

How can recombinant WalK protein be expressed and purified for in vitro studies?

For in vitro studies of WalK function, researchers typically express and purify recombinant WalK protein using the following approach:

  • Construct preparation:

    • Clone the walK gene or specific domains (e.g., residues 196-450 containing the catalytic core) into an expression vector such as pET-His .

    • Include appropriate affinity tags (His-tag, Flag-tag) to facilitate purification .

  • Expression conditions:

    • Transform the construct into a suitable E. coli expression strain.

    • Induce protein expression with IPTG under optimized conditions.

  • Purification protocol:

    • Lyse cells in an appropriate buffer containing protease inhibitors.

    • Perform affinity chromatography using the incorporated tag (e.g., Ni-NTA for His-tagged proteins).

    • Further purify by gel filtration chromatography to ensure homogeneity and exchange into appropriate buffer systems (e.g., 20 mM Tris-HCl, pH 8.0, 200 mM NaCl, and 20% v/v glycerol for ITC experiments) .

    • Verify protein purity by SDS-PAGE and western blotting.

  • Functional validation:

    • Confirm the activity of purified WalK through autophosphorylation assays using ATP or ATPγS .

    • Test interaction with WalR through binding assays like ITC .

This approach yields functional recombinant WalK that can be used for detailed biochemical and biophysical analyses.

What methods are used to generate and validate walK mutations in S. aureus?

Researchers use several complementary approaches to generate and validate walK mutations in S. aureus:

  • Allelic exchange methodology:

    • Construct engineering: Create plasmids containing the desired walK allele with specific mutations .

    • Transformation: Introduce the constructs into target S. aureus strains.

    • Selection: Use appropriate antibiotics to select for transformants where homologous recombination has occurred.

    • Confirmation: Verify the introduction of specific mutations by PCR and DNA sequencing .

  • Marker-free Cre-loxP method (as used in S. mutans studies):

    • Clone the target region into a suitable vector.

    • Engineer a loxP-kanamycin resistance cassette and desired mutations.

    • Transform linearized constructs into bacteria with kanamycin selection.

    • Introduce a plasmid expressing Cre recombinase to excise the integrated loxP-Kan cassette.

    • Remove the Cre plasmid by temperature shifts.

    • Verify mutations by PCR and sequencing .

  • Validation of mutant phenotypes:

    • Growth curve analysis to ensure mutations don't significantly affect bacterial growth .

    • Antimicrobial susceptibility testing to measure changes in vancomycin and daptomycin MICs .

    • Cell wall thickness measurements using electron microscopy .

    • Autolysis assays to assess cell wall metabolism .

    • Transcriptional profiling using RNA-seq to identify changes in gene expression patterns .

These methodologies allow researchers to establish clear cause-effect relationships between specific walK mutations and observed phenotypes.

What is the role of the W-acidic motif in WalK function and how can it be experimentally characterized?

The W-acidic motif in the C-terminal tail (CTT) of WalK plays a crucial role in its function:

  • Structural importance: The W-acidic motif, particularly the conserved tryptophan residue (W443 in S. mutans), is essential for WalK-WalR interaction .

  • Functional significance:

    • Mutation studies have shown that while W443A mutants maintain autokinase activity, they display significantly reduced phosphotransferase activity toward WalR .

    • The W-acidic motif is therefore critical for signal transduction from WalK to WalR.

  • Experimental characterization methods:

    • Site-directed mutagenesis: Generate specific mutations (e.g., W443A, D441A) or deletion of the entire CTT (Δtail) .

    • Binding assays: Use ITC to quantify the binding affinity between WalK variants and WalR. Wild-type WalK binds WalR with a Kd of approximately 1.21 μM, while W443A and Δtail mutants show undetectable interactions .

    • Enzymatic activity assays:

      • Autokinase activity: Measure using ATPγS and anti-thiophosphate antibodies .

      • Phosphotransferase activity: Assess by monitoring the reduction of phosphorylated WalK after incubation with WalR .

      • Phosphatase activity: Evaluate using Phos-tag gels to separate phosphorylated from dephosphorylated WalR .

  • Quantitative analysis: Compare activities between wild-type and mutant proteins over time, with statistical analysis (e.g., Student's t-tests) to identify significant differences .

These experimental approaches reveal that the W-acidic motif is indispensable for WalK-WalR interaction and subsequent signaling, providing insights into the molecular mechanics of this two-component system.

How do the PAS domains of WalK contribute to signal sensing, and what signals might they detect?

The PAS domains of WalK are involved in signal sensing, though the exact signals they detect remain incompletely understood:

Further research is needed to definitively identify the signals sensed by WalK's PAS domains, which would significantly advance our understanding of how S. aureus senses and responds to its environment.

What is the relationship between WalKR and other two-component systems in S. aureus, particularly in the context of antimicrobial resistance?

The relationship between WalKR and other two-component systems (TCSs) in S. aureus reveals complex regulatory networks, particularly in antimicrobial resistance:

  • Interaction with GraRS:

    • Evidence suggests potential synergistic effects between walKR and graRS mutations in enhancing antimicrobial resistance.

    • For example, the combination of graS (T136I) and walK (G223D) mutations was associated with a higher daptomycin MIC than either mutation alone, suggesting an additive effect of these two mutations to increase both vancomycin and daptomycin resistance .

  • Potential cross-regulation:

    • While S. aureus encodes 16 TCSs that enable the bacteria to sense and respond to changing environmental conditions , the extent of cross-talk between these systems is not fully characterized.

    • Some evidence suggests that mutations in one TCS may influence the activity or expression of others.

  • Hierarchical regulation:

    • WalKR appears to be at the top of regulatory hierarchies controlling cell wall metabolism.

    • Mutations in walKR lead to consistent transcriptional changes that suggest an important role for this regulator in control of central metabolism .

  • Research approaches to study TCS interactions:

    • Comparative transcriptomics of single and double TCS mutants.

    • Epistasis analysis to determine the hierarchy of regulatory effects.

    • Protein-protein interaction studies to identify direct physical interactions between components of different TCSs.

    • Systems biology approaches to model the integrated network of TCS signaling.

Understanding these complex relationships is crucial for developing comprehensive models of antimicrobial resistance mechanisms in S. aureus and identifying potential targets for novel therapeutic strategies.

How might targeting WalK function serve as a strategy for developing novel antimicrobials?

Targeting WalK function represents a promising strategy for developing novel antimicrobials against S. aureus for several reasons:

  • Essential nature: WalKR is an essential regulatory system in S. aureus, making it an attractive target for antimicrobial development .

  • Potential approaches:

    • Inhibiting WalK autokinase activity to prevent phosphorylation of WalR.

    • Disrupting the WalK-WalR interaction, particularly by targeting the critical W-acidic motif .

    • Designing molecules that mimic signals sensed by WalK's PAS domains to inappropriately activate or inhibit WalK function.

    • Developing compounds that lock WalK in an inactive conformation.

  • Considerations for drug development:

    • Target specificity: Design inhibitors that selectively target bacterial WalK without affecting human kinases.

    • Resistance potential: Consider that mutations in walK are already associated with antimicrobial resistance, suggesting potential challenges in resistance development against WalK inhibitors .

    • Effectiveness: As noted in the search results, "Efforts to design therapeutic strategies based on inhibiting walKR should be aware of the potential impact on the organism of inducing mutations in this locus" .

  • Potential advantages:

    • Novel mechanism of action distinct from current antibiotics.

    • Possibility of restoring susceptibility to existing antibiotics like vancomycin and daptomycin when used in combination.

    • Potential to attenuate virulence without directly killing bacteria, which might reduce selective pressure for resistance development.

This approach requires careful consideration of bacterial adaptation mechanisms but holds promise for addressing the critical need for new antimicrobial strategies against resistant S. aureus.

What are the implications of WalK mutations for diagnostic approaches to identify resistant S. aureus strains?

The association between WalK mutations and antimicrobial resistance has significant implications for developing diagnostic approaches to identify resistant S. aureus strains:

  • Molecular markers for resistance:

    • Specific mutations in walK and walR have been identified in VISA strains, making them potential molecular markers for resistance detection .

    • These mutations could be targeted in molecular diagnostic assays to rapidly identify resistant isolates without waiting for traditional susceptibility testing.

  • Diagnostic strategies:

    • Targeted sequencing of the walKR locus to identify known resistance-associated mutations.

    • Development of PCR-based assays or DNA microarrays targeting common walKR mutations.

    • Next-generation sequencing approaches to simultaneously detect mutations in walKR and other resistance-associated loci.

    • Phenotypic assays that specifically detect the consequences of walKR mutations, such as cell wall thickening or altered autolysis.

  • Predictive diagnostics:

    • Identifying walKR mutations could potentially predict cross-resistance to daptomycin, even in isolates from patients never treated with this antibiotic .

    • This could guide appropriate antibiotic selection and prevent treatment failures.

  • Challenges:

    • The diversity of mutations that can occur in walKR.

    • The contribution of mutations in other loci to the resistance phenotype.

    • Distinguishing between mutations that cause resistance and those that are compensatory or unrelated to resistance.

Incorporating walKR mutation analysis into diagnostic workflows could enhance the early detection of resistant S. aureus strains and improve antimicrobial stewardship efforts.

What are common technical challenges in studying WalK function and how can they be addressed?

Researchers face several technical challenges when studying WalK function, along with potential solutions:

  • Protein expression and purification:

    • Challenge: WalK is a membrane-associated histidine kinase, making full-length protein expression and purification difficult.

    • Solution: Express and study functional domains separately (e.g., the cytoplasmic portion containing residues 196-450 or 31-450) , use specialized detergents for membrane protein solubilization, or develop membrane mimetic systems.

  • Maintaining protein function during purification:

    • Challenge: Histidine kinases may lose activity during purification steps.

    • Solution: Include glycerol (e.g., 20% v/v) in buffers to stabilize protein structure, optimize buffer conditions (pH, salt concentration), and minimize freeze-thaw cycles .

  • Detecting phosphorylation states:

    • Challenge: The phosphohistidine bond in WalK is labile and difficult to detect.

    • Solution: Use alternative approaches such as ATPγS-based protocols with anti-thiophosphate antibodies or specialized anti-N1-phosphohistidine antibodies for detection .

  • Analyzing phosphotransfer kinetics:

    • Challenge: Direct quantification of phosphorylated WalR is difficult due to the intrinsic phosphatase activity of WalK.

    • Solution: Analyze phosphotransferase activity indirectly by measuring the reduction of phosphorylated WalK over time .

  • Creating precise genomic mutations:

    • Challenge: Introducing specific walK mutations into the S. aureus genome without unintended mutations.

    • Solution: Use marker-free approaches like the Cre-loxP method, carefully validate mutations by genome sequencing to ensure no additional mutations are introduced .

  • Validating phenotypic changes:

    • Challenge: Determining whether observed phenotypes are directly due to walK mutations.

    • Solution: Perform bi-directional allelic exchange experiments, create complementation strains, and conduct comprehensive phenotypic characterization .

Addressing these technical challenges requires careful experimental design and validation to ensure accurate interpretation of results related to WalK function.

How can researchers verify that experimental WalK mutations don't introduce unintended effects or mutations?

Verifying that experimental WalK mutations don't introduce unintended effects or mutations is crucial for accurate interpretation of results. Researchers should employ the following approaches:

  • Comprehensive genomic verification:

    • Whole genome sequencing of mutant strains to confirm that only the intended mutations are present. As noted in one study: "Ion Torrent genome sequencing confirmed no additional regulatory mutations had been introduced into either the walR or walK VISA mutants during the allelic exchange process" .

    • If full genome sequencing is not feasible, at minimum, sequencing of the entire walKR operon and adjacent regions.

  • Control for spontaneous mutations:

    • Include appropriate control strains in all experiments.

    • Create multiple independent mutants with the same intended modification and compare their phenotypes.

    • If possible, create revertant strains by restoring the wild-type sequence and confirm phenotype reversal.

  • Growth and fitness assessment:

    • Monitor growth curves to ensure mutations don't significantly affect bacterial growth or viability. For example: "All bacterial strains grew at the same rate as WT" .

    • Check for unexpected colony morphology or other phenotypic changes.

  • Detection of potential compensatory mutations:

    • Be aware that compensatory mutations may arise to counterbalance negative effects of the primary mutation. For instance: "two potential compensatory mutations were detected within putative transport genes for the walK mutant" .

    • These compensatory mutations can complicate interpretation of results.

  • Validation across different genetic backgrounds:

    • Test effects of mutations in multiple strain backgrounds to ensure consistency.

    • Consider the impact of strain-specific factors on mutation outcomes.

  • Transcriptional profiling:

    • Use RNA-seq or similar approaches to assess whether the introduced mutations cause unexpected changes in global gene expression patterns .

    • Compare transcriptional changes to established WalKR regulons to ensure consistency.

These rigorous validation approaches help ensure that observed phenotypes are specifically attributable to the intended walK mutations rather than unintended genetic alterations.

What are important unanswered questions about WalK structure-function relationships?

Several important questions about WalK structure-function relationships remain unanswered and represent fertile areas for future research:

  • Signal recognition mechanisms:

    • What specific signals are sensed by the extracellular and intracellular PAS domains of WalK?

    • How do these signals trigger conformational changes that modulate WalK activity?

    • Are there specific binding pockets or interaction surfaces involved in signal detection?

  • Domain interactions and allosteric regulation:

    • How do the different domains of WalK (PAS domains, histidine kinase domain, CTT) communicate with each other?

    • What conformational changes occur during signal transduction?

    • How does the W-acidic motif specifically mediate WalK-WalR interactions at the molecular level?

  • Fine-tuning of enzymatic activities:

    • What determines the balance between WalK's autokinase, phosphotransferase, and phosphatase activities?

    • How do specific mutations in walK alter this balance to contribute to antibiotic resistance?

    • Can these activities be selectively targeted for therapeutic purposes?

  • Species-specific variations:

    • How do structural and functional differences in WalK across bacterial species (e.g., S. aureus vs. S. mutans) contribute to species-specific behaviors?

    • Are there conserved mechanisms that can be targeted broadly, or are species-specific approaches required?

  • Interaction with other cellular components:

    • Besides WalR, does WalK interact with other proteins or cellular components?

    • Are there accessory proteins that modulate WalK function in vivo?

    • How is WalK spatially organized in the bacterial membrane, and does this organization affect its function?

Addressing these questions would significantly advance our understanding of WalK function and potentially reveal new approaches for antimicrobial development targeting this essential regulatory system.

How might emerging technologies enhance our understanding of WalK function in S. aureus?

Emerging technologies offer exciting opportunities to deepen our understanding of WalK function in S. aureus:

  • Cryo-electron microscopy (cryo-EM):

    • Could provide high-resolution structures of the full-length WalK protein in different conformational states.

    • May reveal the structural basis for signal detection and transmission across domains.

    • Could capture WalK-WalR complexes to understand the molecular details of their interaction.

  • Single-molecule techniques:

    • Single-molecule FRET (Förster Resonance Energy Transfer) could monitor conformational changes in WalK upon signal detection in real-time.

    • Optical tweezers or atomic force microscopy might measure forces associated with WalK conformational changes.

    • These approaches could provide insights into the dynamics of WalK function not accessible through static structural studies.

  • Advanced genomic tools:

    • CRISPR-Cas9 technology for precise genome editing could facilitate creation of subtle mutations to map structure-function relationships.

    • CRISPRi/CRISPRa systems could enable fine-tuned modulation of walK expression to study dose-dependent effects.

    • High-throughput mutagenesis approaches coupled with next-generation sequencing could systematically map functional residues.

  • Systems biology approaches:

    • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics) could provide a comprehensive view of WalK's impact on cellular physiology.

    • Mathematical modeling of the WalKR system could predict behaviors under various conditions and guide experimental design.

    • Network analysis could place WalK within the broader context of S. aureus regulatory networks.

  • Microfluidics and single-cell analysis:

    • Could reveal cell-to-cell variability in WalK activity and its consequences for population-level behaviors.

    • May enable real-time monitoring of WalK activity in response to changing environmental conditions.

    • Could facilitate high-throughput screening for WalK inhibitors or modulators.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.