Recombinant Staphylococcus aureus Serine protease htrA-like (MW0903)

What is the molecular structure of Staphylococcus aureus HtrA-like serine protease (MW0903)?

Staphylococcus aureus HtrA-like serine protease (MW0903) is a full-length protein consisting of 769 amino acids (1-769aa) with UniProt identifier Q8NXB8. The protein contains specific functional domains typical of the HtrA family, including a catalytic domain with the active site centered around a serine residue. The protein's complete amino acid sequence is:

MDIGKKHVIPKSQYRRKRREFFHNEDREENLNQHQDKQNIDNTTSKKADKQIHKDSIDKHERFKNSLSSHLEQRNRDVNENKAEESKSNQDSKSAYNRDHYLTDDVSKKQNSLDSVDQDTEKSKYYEQNSEATLSTKSTDKVESTDMRKLSSDKNKVGHEEQHVLSKPSEHDKETRIDFESSRTDSDSSMQTEKIKKDSSDGNKSSNLKSEVISDKSNTVPKLSESDDEVNNQKPLTLPEEQKLKRQQSQNEQTKTYTYGDSEQNDKSNYENDLSHHMPSIS
DDKDNVMRENHIVDDNPDNDINTPSLSKTDDDRKLDEKIHVEDKHKQNADSSETVGYQSQSSASHRITEKRNNAINDHD
KLNGQKPNAKTSANNNQKKATSKLNKGRATNNNYSDILKKFWMMYWPKLVILMGIIILIVILNAIFNNVNKNDRMNDNNDADAQKYTTTMKNANNTVKSVVTVENETSKDSSLPKDKASQDEVGSGVVYKKSGDTLYIVTNAHVVGDKENQKITFSNNKSVVGKVLGKDKWSDLAVVKATSSDSSVKEIAIGDSNNLVLGEPILVVGNPLGVDFKGTVTEGIISGLNRNVPIDFDKDNKYDMLMKAFQIDASVNPGNSGGAVVNREGKLIGVVAAKISMPNVENMSFAIPVNEVQKIVKDLETKGKIDYPDVGVKMKNIASLNSFERQAVKLPGKVKNGVVVDQVDNNGLADQSGLKKGDVITELDGKLLEDDLRFRQIIFSHKDDLKSITAKIYRDGKEKEINIKLK

For recombinant expression, the protein is typically fused to an N-terminal His-tag, which facilitates purification while maintaining functional activity.

How does S. aureus HtrA-like protease compare structurally to other bacterial HtrA proteases?

S. aureus encodes two HtrA-like proteases (HtrA1 and HtrA2) with structural similarities to other bacterial HtrA family members. Sequence analysis reveals significant homology with E. coli DegP, with bacterial HtrA proteases typically sharing 40-45% sequence identity. For instance, Helicobacter pylori HtrA shows approximately 42% sequence identity with E. coli DegP .

The conserved catalytic triad (serine-histidine-aspartate) characteristic of serine proteases is present in S. aureus HtrA-like protease, though specific residue positions may vary slightly from other bacterial HtrAs, potentially affecting catalytic efficiency and substrate recognition.

What are the primary biological functions of S. aureus HtrA-like proteases in bacterial physiology?

S. aureus HtrA-like proteases serve multiple critical functions in bacterial physiology, with their roles varying between strains. Research using different S. aureus backgrounds (RN6390 and COL) has revealed strain-specific functions:

• Stress Response and Survival: Both HtrA1 and HtrA2 contribute to bacterial survival under stress conditions. In the COL strain, both proteases are essential for thermal stress tolerance, while in RN6390, HtrA1 specifically confers protection against puromycin-induced stress . This stress-protective function appears to involve both proteolytic and chaperone activities, with the latter potentially being more significant for stress resistance.

• Virulence Factor Regulation: In the RN6390 genetic background, the combined inactivation of both HtrA1 and HtrA2 significantly affects the expression of secreted virulence factors that comprise the agr regulon. Molecular analysis revealed that this phenotype correlates with the absence of the agr RNA III transcript in the double mutant, suggesting HtrA proteases influence regulatory pathways controlling virulence factor expression .

• Pathogenicity Contribution: HtrA proteases contribute to S. aureus pathogenicity through their influence on extracellular factor production. In virulence studies using a rat model of endocarditis, the RN6390 htrA1 htrA2 double mutant showed diminished virulence, though this effect was strain-specific and not observed in the COL background .

These findings indicate that S. aureus HtrA proteases function in a strain-dependent manner, likely due to specific differences in the regulation of virulence factors and stress protein expression across different genetic backgrounds.

How do HtrA-like proteases contribute to S. aureus virulence mechanisms?

HtrA-like proteases contribute to S. aureus virulence through multiple mechanisms that enhance bacterial survival and pathogenicity:

• Regulatory Function in Virulence Expression: S. aureus HtrA proteases influence the agr (accessory gene regulator) system, a major regulatory network controlling virulence gene expression. The double inactivation of both HtrA1 and HtrA2 in the RN6390 strain correlates with the disappearance of the agr RNA III transcript, a key regulatory RNA that modulates the production of numerous extracellular virulence factors . This suggests HtrA proteases may ensure proper functioning of the agr system components.

• Protein Quality Control: As surface proteases, HtrA proteins likely participate in the quality control of secreted or membrane-associated proteins. This function could include proper folding, maturation, or degradation of misfolded proteins that are essential for bacterial virulence. Evidence suggests that HtrA proteases may ensure folding and/or maturation of surface components of the agr system, thereby facilitating effective quorum sensing and virulence regulation .

• Stress Resistance: By enhancing bacterial survival under stress conditions encountered during infection (e.g., thermal stress, oxidative stress), HtrA proteases indirectly support virulence by maintaining bacterial viability in hostile host environments .

It's important to note that the contribution of HtrA proteases to virulence appears strain-dependent. While the RN6390 htrA1 htrA2 double mutant showed diminished virulence in a rat endocarditis model, similar mutations in the COL strain did not significantly affect virulence in the same model . This strain specificity highlights the complex integration of HtrA functions within different S. aureus genetic backgrounds.

What are the optimal expression and purification conditions for recombinant S. aureus HtrA-like (MW0903) protein?

For optimal expression and purification of recombinant S. aureus HtrA-like (MW0903) protein, the following protocol is recommended based on established methodologies:

Expression System:

• Host: E. coli expression system is most commonly used due to high yield and ease of genetic manipulation

• Vector: Expression vectors containing N-terminal His-tag for affinity purification

• Induction conditions: Typically IPTG induction at mid-log phase growth (OD600 0.6-0.8)

• Growth temperature: 25-30°C post-induction to enhance proper folding of the protease domain

Purification Protocol:

• Cell Lysis: Sonication or mechanical disruption in Tris/PBS-based buffer (pH 8.0)

• Initial Clarification: Centrifugation at 15,000-20,000 × g to remove cell debris

• Affinity Chromatography: Ni-NTA resin capture exploiting the His-tag

• Washing: Gradient imidazole washing to remove non-specifically bound proteins

• Elution: Higher concentration imidazole buffer (typically 250-300 mM)

• Buffer Exchange: Dialysis or gel filtration into storage buffer (Tris/PBS-based buffer with 6% Trehalose, pH 8.0)

Storage Conditions:

• Short-term: 4°C for up to one week

• Long-term: Store at -20°C/-80°C with 50% glycerol as cryoprotectant

• Aliquoting is necessary to avoid repeated freeze-thaw cycles

• Lyophilization is an alternative for extended storage stability

Reconstitution Protocol:

• Centrifuge vial briefly before opening

• Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

• Add glycerol to final concentration of 5-50% for long-term storage

This protocol typically yields recombinant protein with greater than 90% purity as determined by SDS-PAGE analysis.

What enzymatic assays can be used to assess the proteolytic activity of S. aureus HtrA-like protease?

Several enzymatic assays can be employed to evaluate the proteolytic activity of S. aureus HtrA-like protease, each with specific advantages for different research questions:

1. Substrate-Specific Cleavage Assays:

• Casein Degradation Assay: HtrA proteases typically demonstrate caseinolytic activity. This can be assessed using either fluorescently labeled casein substrates or zymography techniques with casein-containing gels. This is considered a standard artificial substrate for initial activity screening .

• E-cadherin Cleavage Assay: Based on findings with HtrA from other bacterial species, E-cadherin may serve as a biologically relevant substrate. Incubating purified HtrA with recombinant E-cadherin and monitoring cleavage products by Western blot using antibodies against E-cadherin can detect specific proteolytic activity. Look for the generation of the characteristic 85-kDa N-terminal fragment (NTF) .

• Fibronectin Degradation Assay: Similar to E-cadherin assays, HtrA's ability to cleave fibronectin can be assessed by incubating purified enzyme with fibronectin and monitoring degradation patterns by SDS-PAGE or Western blot .

2. Comparative Activity Profiling:

• Protease Activity Testing Against Multiple Substrates: Comprehensive profiling with multiple potential substrates (IgA, EGFR, JAM) can help establish substrate specificity patterns .

• Inactivated Controls: Include catalytically inactive HtrA variants (e.g., serine-to-alanine substitution at the active site) as negative controls to confirm that observed activity is specifically due to HtrA protease function .

3. Inhibition Studies:

• Inhibitor Screening: Using serine protease inhibitors like phenylmethyl-sulphonylfluorid or small molecule inhibitors (similar to the HHI inhibitor identified for H. pylori HtrA) to verify that activity is specifically due to serine protease function .

4. Cellular Assays:

• Cell-Based Assays: Applying purified HtrA to cultured epithelial cells and monitoring the cleavage of cellular junctional proteins by immunoblotting supernatants and cell lysates or by immunofluorescence microscopy .

For quantitative assessment, calculating kinetic parameters (Km, Vmax) using varying substrate concentrations and enzyme amounts will provide valuable biochemical characterization of the protease activity. Activity should be reported in standardized units, typically as μmol substrate cleaved per minute per mg of enzyme under defined conditions.

How do mutations in the active site affect the dual protease-chaperone function of S. aureus HtrA?

Mutations in the active site of S. aureus HtrA have distinct effects on its dual protease-chaperone functions, providing important insights into structure-function relationships:

Retention of Chaperone Function:
Interestingly, experimental evidence indicates that active site mutations may not completely eliminate the protein's biological function. Studies with S. aureus HtrA1 expressed in a heterologous system (L. lactis) showed that despite displaying weak proteolytic activity, HtrA1 conferred significant protection against thermal stress . This observation suggests that chaperone activity may be largely independent of proteolytic function and potentially represents the dominant mechanism for stress protection.

Structural Consequences:
The active site architecture affects the balance between protease and chaperone functions. Mutations in the active site or surrounding residues may alter:

• Substrate binding pocket geometry

• Protein-protein interaction interfaces

• Oligomerization properties that influence chaperone function

• Conformational dynamics that regulate switching between proteolytic and chaperone states

The differential effects of active site mutations provide valuable experimental tools for dissecting the relative contributions of proteolytic versus chaperone activities to various biological functions of HtrA proteins in S. aureus physiology and pathogenesis.

What is the relationship between S. aureus HtrA proteases and the agr regulatory system in different strain backgrounds?

The relationship between S. aureus HtrA proteases and the agr regulatory system exhibits strain-specific characteristics that reflect the complex regulatory networks in different S. aureus genetic backgrounds:

Strain-Dependent Effects on agr System:

In the RN6390 background:

• The double mutation of htrA1 and htrA2 results in the disappearance of the agr RNA III transcript, a key regulatory RNA that modulates the production of numerous extracellular virulence factors .

• This molecular phenotype correlates with altered expression of several secreted virulence factors that comprise the agr regulon, demonstrating a functional consequence of disrupted agr signaling .

• The virulence of the RN6390 htrA1 htrA2 double mutant is diminished in a rat model of endocarditis, suggesting that the HtrA-agr relationship has significant implications for pathogenicity in this strain background .

In the COL background:

• Despite the importance of both HtrA1 and HtrA2 for thermal stress survival, mutations in these genes have only minor effects on exoprotein expression (with HtrA1 showing a slight effect) .

• The htrA mutations do not significantly diminish virulence in the rat endocarditis model for the COL strain .

• This suggests that in the COL background, alternative regulatory mechanisms may compensate for HtrA function in virulence factor expression.

Mechanistic Models:

Several potential mechanisms could explain how HtrA proteases influence the agr system:

• Direct Processing of agr Components: HtrA proteases may be involved in the processing or maturation of agr system components, such as AgrD (the precursor of the autoinducing peptide) or the transmembrane protein AgrB .

• Quality Control of Surface Components: HtrA may ensure proper folding and/or assembly of membrane-associated components of the agr system, such as the AgrC sensor kinase .

• Indirect Regulatory Effects: HtrA proteases might influence other regulatory factors that interact with the agr system, such as the stress response sigma factor σB or the DNA binding protein SarA (staphylococcal accessory regulator) .

These strain-specific differences highlight the importance of considering genetic background when investigating virulence regulation in S. aureus and emphasize the complex integration of HtrA functions within different regulatory networks.

How does S. aureus HtrA-like protease activity compare with HtrA proteases from other bacterial species?

S. aureus HtrA-like proteases display distinct characteristics when compared to HtrA proteases from other bacterial species, reflecting evolutionary adaptations to different ecological niches and pathogenic strategies:

Substrate Specificity Comparison:

The substrate specificity of S. aureus HtrA differs from other bacterial HtrAs:

• While Helicobacter pylori HtrA efficiently degrades E-cadherin and fibronectin as biologically relevant substrates, S. aureus HtrA1 demonstrated only weak protease activity when tested against several substrates .

• This contrasts with H. pylori HtrA, which exhibits strong proteolytic activity against specific host cell junction proteins, directly contributing to epithelial barrier disruption .

• E. coli DegP, another well-characterized HtrA family member, shows different substrate preferences compared to both H. pylori and S. aureus HtrAs, reflecting adaptation to its specific biological roles .

Functional Emphasis:

Different bacterial HtrAs show varying balances between proteolytic and chaperone functions:

• S. aureus HtrA1 appears to emphasize chaperone activity over proteolytic function, as demonstrated by its ability to confer thermal stress protection despite weak protease activity .

• In contrast, H. pylori HtrA functions as a potent secreted virulence factor with strong proteolytic activity against host cell proteins .

• E. coli DegP demonstrates temperature-dependent switching between chaperone and protease activities, with chaperone function predominating at lower temperatures and proteolytic activity increasing at elevated temperatures.

Structural Basis for Functional Differences:

Sequence alignments and structural analyses of HtrA proteases from different bacterial species reveal:

This comparative analysis highlights the evolutionary diversification of HtrA proteases to serve species-specific functions in bacterial physiology and pathogenesis.

What methodological approaches are most effective for studying the functional differences between HtrA1 and HtrA2 in S. aureus?

To effectively study the functional differences between HtrA1 and HtrA2 in S. aureus, researchers should employ multiple complementary methodological approaches:

1. Genetic Manipulation Strategies:

• Single and Double Mutant Construction: Generate isogenic mutants with individual knockouts (htrA1, htrA2) and double knockouts (htrA1 htrA2) in multiple S. aureus strain backgrounds (e.g., RN6390, COL, clinical isolates) to reveal strain-specific functions .

• Complementation Studies: Re-introduce wild-type or mutated versions of each htrA gene to confirm phenotypes and dissect specific functional domains.

• Domain Swap Experiments: Create chimeric proteins exchanging domains between HtrA1 and HtrA2 to identify regions responsible for specific functions.

2. Phenotypic Characterization Approaches:

• Stress Response Profiling: Evaluate growth under various stress conditions (thermal, oxidative, antibiotic) to define stress-specific roles of each HtrA protein .

• Virulence Factor Expression Analysis: Use proteomics and transcriptomics to comprehensively assess effects on extracellular protein production and regulatory RNA levels (particularly agr RNA III) .

• In vivo Infection Models: Employ multiple animal models (e.g., rat endocarditis model, mouse sepsis model) to assess strain-specific contributions to virulence .

3. Biochemical and Structural Characterization:

• Comparative Enzymatic Assays: Perform side-by-side analysis of substrate specificity and enzymatic kinetics using recombinant proteins.

• Active Site Mutagenesis: Create catalytically inactive variants of each protein to dissect relative contributions of proteolytic versus chaperone functions .

• Structural Analysis: Use X-ray crystallography or cryo-electron microscopy to determine and compare three-dimensional structures.

4. Protein Interaction Studies:

• Substrate Identification: Employ techniques like BioID or crosslinking-mass spectrometry to identify natural substrates of each HtrA protease.

• Interactome Analysis: Characterize the protein-protein interaction networks of HtrA1 and HtrA2, particularly focusing on components of the agr system.

• Localization Studies: Use immunofluorescence microscopy or subcellular fractionation to determine if the two proteases localize to different cellular compartments.

5. Systems Biology Approaches:

• Multi-omics Integration: Combine transcriptomics, proteomics, and metabolomics data from mutant strains to build comprehensive functional networks.

• Regulatory Network Modeling: Develop mathematical models of HtrA involvement in stress response and virulence regulation across different strain backgrounds.

By integrating these diverse methodological approaches, researchers can develop a comprehensive understanding of the distinct and overlapping functions of HtrA1 and HtrA2 in S. aureus physiology and pathogenesis.