Recombinant Staphylococcus aureus Serine protease htrA-like (SA0879)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Staphylococcus aureus Serine Protease HtrA-like (SA0879)

Recombinant Staphylococcus aureus Serine protease HtrA-like (SA0879) is a genetically engineered protein derived from the htrA gene of S. aureus. This protease belongs to the High-Temperature Requirement A (HtrA) family, which plays critical roles in bacterial stress response, virulence regulation, and extracellular protein quality control . In S. aureus, HtrA homologs are implicated in pathogenicity through their dual protease-chaperone activities and interactions with key virulence regulatory systems like the agr (accessory gene regulator) pathway .

Stress Response

  • Thermal and oxidative stress: SA0879 contributes to bacterial survival under heat shock (42°C) and puromycin-induced stress .

  • Autolysis regulation: Transcriptomic studies show SA0879 downregulation (fold change: 0.50, p < 0.001) in autolysis-deficient S. aureus mutants, linking it to cell wall turnover .

Virulence Modulation

  • Secreted virulence factors: In S. aureus RN6390, HtrA1/HtrA2 double mutants show reduced hemolysin production and diminished virulence in rat endocarditis models .

  • agr regulon interaction: HtrA proteases stabilize surface components of the agr quorum-sensing system, affecting RNA III transcript levels and exoprotein secretion .

Gene Expression and Mutant Phenotypes

A transcriptomic analysis of S. aureus strains revealed:

GeneFunctionFold Changep-valueSignificance
SA0879Serine protease HtrA0.50<0.001Downregulated in autolysis-deficient strains

Comparative Strain Analysis

  • RN6390 strain: HtrA1/HtrA2 double mutants lose RNA III (agr effector) expression, impairing virulence .

  • COL strain: Both HtrA1 and HtrA2 are essential for thermal stress survival but do not affect virulence in endocarditis models .

Applications and Research Tools

Recombinant SA0879 is utilized in:

  • Drug discovery: Targeting HtrA proteases to disrupt S. aureus stress adaptation .

  • Pathogenesis studies: Elucidating mechanisms of agr-dependent virulence regulation .

  • Diagnostic development: Detecting HtrA-specific antibodies in S. aureus infections .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on shipping method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and storing in aliquots at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is assigned during production. If you require a specific tag, please inform us; we will prioritize your request.
Synonyms
SA0879; Serine protease HtrA-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-769
Protein Length
full length protein
Species
Staphylococcus aureus (strain N315)
Target Names
SA0879
Target Protein Sequence
MDIGKKHVIPKSQYRRKRREFFHNEDREENLNQHQDKQNIDNTTSKKADKQIHKDSIDKH ERFKNSLSSHLEQRNRDVNENKAEESKSNQDSKSAYNRDHYLTDDVSKKQNSLDSVDQDT EKSKYYEQNSEATLSTKSTDKVESTEMRKLSSDKNKVGHEEQHVLSKPSEHDKETRIDSE SSRTDSDSSMQTEKIKKDSSDGNKSSNLKSEVISDKSNTVPKLSESDDEVNNQKPLTLPE EQKLKRQQSQNEQTKTYTYGDSEQNDKSNHENDLSHHTPSISDDKDNVMRENHIVDDNPD NDINTLSLSKIDDDRKLDEKIHVEDKHKQNADSSETVGYQSQSTASHRSTEKRNISINDH DKLNGQKTNTKTSANNNQKKATSKLNKGRATNNNYSDILKKFWMMYWPKLVILMGIIILI VILNAIFNNVNKNDRMNDNNDADAQKYTTTMKNANNTVKSVVTVENETSKDSSLPKDKAS QDEVGSGVVYKKSGDTLYIVTNAHVVGDKENQKITFSNNKSVVGKVLGKDKWSDLAVVKA TSSDSSVKEIAIGDSNNLVLGEPILVVGNPLGVDFKGTVTEGIISGLNRNVPIDFDKDNK YDMLMKAFQIDASVNPGNSGGAVVNREGKLIGVVAAKISMPNVENMSFAIPVNEVQKIVK DLETKGKIDYPDVGVKMKNIASLNSFERQAVKLPGKVKNGVVVDQVDNNGLADQSGLKKG DVITELDGKLLEDDLRFRQIIFSHKDDLKSITAKIYRDGKEKEINIKLK
Uniprot No.

Target Background

Database Links

KEGG: sau:SA0879

Protein Families
Peptidase S1C family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Staphylococcus aureus Serine protease htrA-like (SA0879)?

Staphylococcus aureus Serine protease htrA-like (SA0879) is one of two putative HtrA-like proteases encoded by S. aureus, commonly referred to as HtrA1 and HtrA2. This protein is identified in the UniProt database with accession number Q7A6C9 and was isolated from the S. aureus strain N315 . The protein belongs to the family of HtrA (high-temperature requirement A) proteases, which are serine proteases involved in protein quality control and stress response mechanisms in bacteria. The amino acid sequence includes multiple domains that contribute to its function, including the catalytic domain responsible for its proteolytic activity.

Unlike cysteine proteases such as staphopain A (ScpA), which is involved in host cell death and intracellular bacterial escape, HtrA-like proteases typically function in protein quality control by degrading misfolded proteins, especially under stress conditions . The complete amino acid sequence of SA0879 contains 446 amino acids, with multiple potential phosphorylation and protein interaction sites that may regulate its activity and substrate specificity.

How do HtrA-like proteases function in bacterial stress responses?

HtrA-like proteases serve as crucial components in bacterial stress response mechanisms, particularly in thermal stress survival. In S. aureus strains like COL, both HtrA1 and HtrA2 are essential for thermal stress survival, highlighting their role in protein quality control under elevated temperature conditions . The proteases recognize and degrade misfolded or damaged proteins that accumulate during stress, preventing their aggregation which could be toxic to the cell.

The mechanism involves recognition of exposed hydrophobic residues in misfolded proteins, followed by proteolytic degradation. Evidence from mutant studies indicates that the inactivation of HtrA1 in strain RN6390 results in sensitivity to puromycin-induced stress, demonstrating its importance in managing chemical stressors . This stress response function appears to be conserved across different bacterial species, though the specific roles and relative importance of HtrA1 versus HtrA2 can vary significantly between different S. aureus strains.

Unlike some other proteases that function primarily as virulence factors through direct host tissue damage, HtrA-like proteases contribute to bacterial survival by maintaining protein homeostasis within the bacterial cell itself, which indirectly supports pathogenicity by enabling bacterial persistence under hostile host conditions.

How does HtrA-like protease function differ between S. aureus strains?

Research demonstrates significant strain-specific differences in HtrA-like protease function within S. aureus. In strain RN6390, the htrA1 htrA2 double mutant showed altered expression of several secreted virulence factors comprising the agr regulon, with a corresponding disappearance of the agr RNA III transcript . This regulatory effect on virulence factor expression resulted in diminished virulence in a rat model of endocarditis. The connection between HtrA proteases and the agr quorum sensing system represents a critical link between stress response and virulence regulation in this strain.

In contrast, in the COL strain, while both HtrA1 and HtrA2 were essential for thermal stress survival, only HtrA1 showed a slight effect on exoprotein expression . Notably, htrA mutations in the COL strain did not reduce virulence in the rat endocarditis model, unlike in the RN6390 strain. This strain-specific variation suggests that the genetic background of different S. aureus isolates significantly influences how HtrA proteases contribute to bacterial physiology and pathogenesis.

These differences may reflect adaptations to specific environmental niches or host interactions, with some strains relying more heavily on HtrA-mediated stress responses for virulence than others. Researchers should therefore carefully consider strain selection when designing experiments to study HtrA function, as findings may not generalize across all S. aureus lineages.

What experimental models are most appropriate for studying HtrA-like proteases in pathogenicity?

The selection of appropriate experimental models for studying HtrA-like proteases in S. aureus pathogenicity depends on the specific aspects of virulence being investigated. The rat model of endocarditis has proven valuable for assessing the in vivo relevance of these proteases, demonstrating strain-specific differences in virulence attenuation following htrA mutation . This model effectively simulates the complex host-pathogen interactions occurring during invasive S. aureus infections.

For evaluating the role of HtrA proteases in bacterial stress response and survival, thermal challenge experiments and exposure to protein-denaturing agents like puromycin provide direct assessment of protease function in protein quality control. Cellular infection models using epithelial cells or phagocytes can reveal the contribution of these proteases to intracellular survival and cytotoxicity, though this approach may be more relevant for studying other proteases like staphopain A that directly mediate host cell interactions .

In the rat endocarditis model, experimental protocols typically involve:

  • Bacterial challenge with defined CFU counts of wild-type and mutant strains

  • Sacrifice of animals at specific timepoints (e.g., 16 hours post-infection)

  • Enumeration of bacteria in vegetation, spleen, and blood

  • Statistical analysis using Fisher exact test for infection rates and Mann-Whitney test for bacterial densities

This experimental framework allows for robust quantitative assessment of virulence differences between wild-type strains and htrA mutants, with significance typically defined as P values ≤0.05 using two-tailed tests.

How do HtrA-like proteases interact with virulence regulatory networks?

HtrA-like proteases interact with virulence regulatory networks in S. aureus through complex mechanisms that appear to be strain-dependent. In the RN6390 background, inactivation of both HtrA1 and HtrA2 results in the disappearance of the agr RNA III transcript, a key regulatory RNA that controls the expression of multiple virulence factors . This finding suggests that HtrA proteases either directly or indirectly influence the agr quorum sensing system, a central regulator of staphylococcal virulence.

The agr system controls the expression of numerous secreted toxins and enzymes, transitioning bacteria from a colonization phenotype (expressing adhesins) to an invasive phenotype (expressing toxins and degradative enzymes). The observation that HtrA proteases affect this system places them at a critical intersection between stress response and virulence regulation. Potential mechanisms may include:

  • Proteolytic processing of regulatory proteins within the agr signaling pathway

  • Degradation of misfolded proteins that would otherwise interfere with agr signaling

  • Response to environmental stresses that normally trigger agr activation

Unlike the direct cytotoxic activity observed with staphopain A, which contributes to host cell death through direct proteolytic activity after translocation into the host cell cytoplasm , HtrA proteases appear to function primarily through modulation of bacterial gene expression programs. This regulatory role makes them potential targets for anti-virulence therapies that could attenuate pathogenicity without directly killing bacteria, potentially reducing selective pressure for resistance.

What are the optimal conditions for expressing and purifying Recombinant S. aureus Serine protease htrA-like (SA0879)?

The expression and purification of Recombinant S. aureus Serine protease htrA-like (SA0879) requires careful optimization to maintain protein stability and activity. Based on established protocols for similar proteases, the following approach is recommended:

Expression system selection should prioritize bacterial systems like E. coli BL21(DE3) with temperature-inducible promoters that allow expression at lower temperatures (16-25°C) to enhance proper folding. The protein should be expressed with a purification tag, typically a 6x or 7x His-tag similar to that used for TEV protease, to facilitate purification using nickel affinity chromatography .

The recommended purification protocol involves:

  • Cell lysis under native conditions using buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, and 10 mM imidazole

  • Affinity chromatography using Ni-NTA resin with step gradient elution

  • Size exclusion chromatography to remove aggregates

  • Storage in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage

Activity assays should be performed immediately after purification to confirm enzymatic function, using fluorogenic peptide substrates containing known cleavage sites. For long-term storage, the addition of 50% glycerol and storage at -20°C or -80°C is recommended to prevent activity loss, with repeated freeze-thaw cycles being avoided as they may compromise protein integrity .

How can the substrate specificity of HtrA-like proteases be determined experimentally?

Determining the substrate specificity of HtrA-like proteases requires a multi-faceted experimental approach combining in vitro biochemical assays with in vivo validation. The following methodology represents current best practices:

Peptide Library Screening:
Design a positional scanning synthetic combinatorial library (PS-SCL) containing diverse amino acid sequences to identify preferred residues at positions surrounding the cleavage site. Following incubation with purified HtrA-like protease, analyze cleaved products using mass spectrometry to establish a consensus recognition motif.

Proteomics-Based Substrate Identification:
Implement TAILS (Terminal Amine Isotopic Labeling of Substrates) or PICS (Proteomic Identification of Cleavage Sites) approaches to identify physiological substrates:

  • Prepare cell lysates from relevant S. aureus strains

  • Incubate with active or inactive (catalytic mutant) HtrA protease

  • Enrich for newly generated N-termini using chemical labeling

  • Identify cleavage sites by LC-MS/MS

  • Validate findings using synthetic peptide substrates

Design of Experiments (DoE) for Optimization:
Apply DoE principles to systematically evaluate factors affecting substrate specificity:

  • Define response variables (e.g., catalytic efficiency, kcat/KM)

  • Identify factors that may influence specificity (pH, temperature, ionic strength)

  • Perform screening experiments to identify significant factors

  • Optimize conditions using full factorial design4

This approach avoids the limitations of one-factor-at-a-time experiments by allowing evaluation of interactions between variables, requiring fewer total experiments while generating more informative data4.

What methods are most effective for comparing the functions of HtrA1 versus HtrA2 in S. aureus?

Comparing the functions of HtrA1 and HtrA2 requires complementary genetic, biochemical, and physiological approaches to distinguish their individual and overlapping roles. The most effective experimental strategy involves:

Genetic Approach:
Generate single (htrA1 or htrA2) and double (htrA1 htrA2) knockout mutants in multiple S. aureus strains using targeted gene disruption. This approach successfully revealed strain-specific differences, with both proteases being essential for thermal stress survival in the COL strain, while showing different effects on virulence factor expression in RN6390 .

Complementation Analysis:
After generating the mutants, perform complementation studies by reintroducing either htrA1 or htrA2 genes (wild-type or catalytically inactive variants) to determine:

  • Whether observed phenotypes can be rescued

  • If the proteolytic activity is required for function

  • Whether one protease can compensate for the other

Phenotypic Profiling:
Assess multiple phenotypes in parallel to create comprehensive functional profiles:

PhenotypeAssay MethodTypical Results in htrA1 MutantTypical Results in htrA2 Mutant
Thermal stressGrowth at elevated temperaturesReduced survival in COL strainReduced survival in COL strain
Chemical stressPuromycin sensitivityIncreased sensitivity in RN6390Minimal effect
Virulence factor expressionExoprotein analysisAltered in RN6390, slight effect in COLMinimal when alone, significant in double mutant with htrA1
VirulenceRat endocarditis modelStrain-dependent reductionMinimal when alone

This multi-parameter assessment allows for nuanced comparison of protease functions across different genetic backgrounds and physiological contexts.

How should researchers interpret contradictory findings regarding HtrA-like protease function across different S. aureus strains?

Contradictory findings regarding HtrA-like protease function across different S. aureus strains should be interpreted within the context of strain-specific genomic and phenotypic variations. The research demonstrates that in the RN6390 strain, htrA mutations significantly impacted virulence in a rat endocarditis model, while in the COL strain, similar mutations had no effect on virulence in the same model . These contradictions represent genuine biological differences rather than experimental artifacts.

To properly interpret such findings, researchers should:

  • Consider genetic background effects: Analyze whole genome sequences of study strains to identify differences in regulatory networks, particularly in stress response pathways that might compensate for the loss of HtrA function.

  • Examine experimental conditions: Subtle differences in infection models can influence outcomes. The rat endocarditis model used in comparative studies maintained consistent protocols, including bacterial enumeration from vegetation, spleen, and blood at 16 hours post-infection .

  • Evaluate compensatory mechanisms: The absence of virulence reduction in COL htrA mutants may reflect strain-specific compensatory mechanisms that maintain virulence factor expression despite the loss of HtrA proteases.

  • Integrate multiple data types: Combining transcriptomic, proteomic, and phenotypic data can reveal how different strains adapt to htrA mutation. For example, the connection between HtrA proteases and agr RNA III expression in RN6390 provides a mechanistic explanation for virulence reduction in this strain .

Rather than viewing contradictions as problems, researchers should recognize them as valuable insights into the diverse roles of HtrA proteases across the S. aureus species complex, reflecting the remarkable adaptability of this important human pathogen.

What statistical approaches are appropriate for analyzing protease activity data?

Analyzing protease activity data requires statistical approaches tailored to the experimental design and distribution characteristics of the data. For studies comparing HtrA protease activity across different conditions or strains, the following statistical framework is recommended:

For Enzymatic Activity Assays:

  • Determine if data follows normal distribution using Shapiro-Wilk test

  • For normally distributed data: Apply parametric tests such as ANOVA followed by post-hoc tests (Tukey's HSD) for multiple comparisons

  • For non-normally distributed data: Use non-parametric alternatives such as Kruskal-Wallis followed by Dunn's test

For In Vivo Virulence Studies:
When analyzing data from animal models such as the rat endocarditis model, use:

  • Fisher's exact test to evaluate differences in infection rates between wild-type and mutant strains

  • Mann-Whitney test to compare bacterial densities in infected tissues

  • Define statistical significance as P values ≤0.05 using two-tailed significance tests

For Design of Experiments (DoE) Approach:
When using full factorial designs to optimize protease activity conditions:

  • Generate response surface models to visualize interaction effects

  • Use ANOVA to identify significant factors and interactions

  • Apply regression analysis to develop predictive models4

Data visualization through properly labeled graphs with error bars representing standard deviation or standard error is essential for accurate interpretation. For complex multi-factor experiments, interaction plots can reveal how different variables collectively influence protease activity.

How can researchers distinguish between direct and indirect effects of HtrA-like proteases on virulence?

Distinguishing between direct and indirect effects of HtrA-like proteases on virulence requires systematic experimental approaches that separate the protein quality control functions from potential direct interactions with virulence factors or regulatory networks.

Experimental Strategies:

  • Protease Activity Mutants: Generate catalytic site mutants that maintain structural integrity but lack proteolytic activity. Compare these with wild-type complementation to determine if the proteolytic function is required for virulence effects.

  • Temporal Analysis: Implement time-course experiments to establish the sequence of events following htrA inactivation. In RN6390, the connection between HtrA proteases and agr RNA III transcript levels suggests an indirect regulatory effect .

  • Substrate Identification: Perform proteomic analyses to identify proteins directly processed by HtrA proteases, distinguishing between degradation of misfolded proteins (quality control function) and specific processing of virulence regulators.

  • Stress-Independent Conditions: Create experimental conditions that minimize cellular stress to separate stress response functions from direct virulence effects.

Interpretation Framework:

ObservationDirect Effect InterpretationIndirect Effect Interpretation
Immediate change in virulence factor expressionLikely direct processing of regulatory proteinsLess likely
Delayed change in virulence factor expressionLess likelyPossible secondary effect via stress response
Effect observed only under stress conditionsLess likelyProbable indirect effect
Phenotype requires protease activityPossible direct effectPossible indirect effect
Physical interaction with virulence regulatorsSupports direct effectLess supportive of indirect effect

This approach allows researchers to develop mechanistic models that accurately represent how HtrA-like proteases influence S. aureus virulence through both direct interactions and broader effects on bacterial physiology.

What emerging technologies could advance the study of HtrA-like proteases in S. aureus?

Recent technological advances offer promising new approaches for characterizing HtrA-like proteases with unprecedented precision. CRISPR interference (CRISPRi) systems adapted for S. aureus allow titratable repression of htrA genes rather than complete knockout, enabling the study of dose-dependent effects and avoiding potential compensatory mechanisms that occur in null mutants.

Quantitative degradomics using advanced mass spectrometry techniques now permits proteome-wide identification of HtrA substrates under various stress conditions, revealing the dynamic substrate landscape. This approach can clarify the mechanistic basis for strain-specific differences in HtrA function by identifying strain-specific substrates.

Super-resolution microscopy techniques can localize HtrA proteases within bacterial cells with nanometer precision, potentially revealing spatial organization that influences function. For instance, localization at membrane interfaces may indicate roles in secretion or sensing environmental stress.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.