Recombinant Staphylococcus aureus Serine protease htrA-like (SAB0888)

Shipped with Ice Packs
In Stock

Description

Overview of HtrA-Like Proteases in Staphylococcus aureus

HtrA (High-temperature requirement A) proteases are conserved bacterial enzymes involved in stress response and virulence. S. aureus encodes two homologs:

  • HtrA1 (SAOUHSC_00958): Associated with stress tolerance (e.g., thermal and puromycin-induced stress) and regulation of virulence factors like hemolysins and proteases .

  • HtrA2: Plays a secondary role in stress survival but contributes synergistically with HtrA1 in certain strains .

These proteases influence pathogenicity by modulating the agr (accessory gene regulator) system, which controls virulence factor expression .

Recombinant HtrA-Like Proteases in Research

Available recombinant products and their applications include:

ProductSupplierIdentifierApplication
Recombinant S. aureus Serine protease htrA-like (SAOUHSC_00958), partialMyBioSourceMBS7076146Study of stress response mechanisms and virulence regulation in S. aureus
Recombinant S. aureus Serine protease htrA-like (SAS0955), partialMyBioSourceMBS7088986Investigation of protease activity and host-pathogen interactions

These recombinant proteins are typically expressed in E. coli, yeast, or mammalian systems and used for functional assays, structural studies, or antibody production .

Strain-Specific Roles

  • RN6390 Strain:

    • Double htrA1/htrA2 mutants showed abolished agr RNA III transcription, reduced extracellular protease activity, and attenuated virulence in rat endocarditis models .

    • HtrA1 is critical for puromycin-induced stress tolerance .

  • COL Strain:

    • Both HtrA1 and HtrA2 are essential for thermal stress survival, but neither significantly affects virulence in endocarditis models .

Mechanism of Action

HtrA proteases likely ensure proper folding/maturation of surface components required for agr signaling, indirectly regulating secreted toxins like α-hemolysin and nucleases .

Evolutionary and Genomic Context

  • Clonal Diversity: HtrA homologs exhibit functional variability across S. aureus lineages (e.g., ST239, ST88), influencing strain-specific adaptation to stress and host environments .

  • Horizontal Gene Transfer: Large-scale chromosomal recombination events in S. aureus (e.g., SCCmec integration) may indirectly affect HtrA regulation by altering stress response pathways .

Research Gaps and Opportunities

  • No direct studies on "SAB0888" were identified, suggesting it may represent a novel or less-characterized variant.

  • Comparative studies using recombinant HtrA proteins could clarify functional divergence between homologs in different strains.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly specify your needs when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please let us know. We will prioritize developing the specified tag if possible.
Synonyms
SAB0888; Serine protease HtrA-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-769
Protein Length
full length protein
Species
Staphylococcus aureus (strain bovine RF122 / ET3-1)
Target Names
SAB0888
Target Protein Sequence
MDIGKKHVIPKSQYRRKRREFFHNEDREENLNQHQDKQNIDNTTLKKAEKQIHKDSIDKH ERFKNSLSSHLEQRNRDVNENKAEESKSNQDSKSAYNRDHYLTDDVSKKQNSLDSVDQDT EKSKYYEQNSEATLSTKSTDKVESSDMRKLSPDKNKVGHEEQHVLSKPSEHDKETRIDFE SSRTDSDSSMQTEKIKKDSSDGNESSNLKSEVISDKSNTVPKLSESDDEVNNQKPLTLPE EQKLKRQQSQNEQTKTYTYGDSEQNDKSNHENDLSHHTPSKSDDKDNVMREDHIVDNNPD NDINTPSLSKIDDDRKLDEKIHVEDKHKQNADSSETVGYQSQSSVSHRSTEKRNMAINDH HKLNGQKLNTKTSANNNQKKATSKLNKGRATNNNYSDILKKFWMMYWPKLVILMGIIILI VILNAIFNNVNKNDRMNDNNDADAQKYTTTMKNANNTVKSVVTVENETSKDSSLPKDKAS QDEVGSGVVYKKSGDTLYIVTNAHVVGDKENQKITFSNNKSVVGKVLGKDKWSDLAVVKA TSSDSSVKEIAIGDSNNLVLGEPILVVGNPLGVDFKGTVTEGIISGLNRNVLIDFDKDNK YDMLMKAFQIDASVNPGNSGGAVVNREGKLIGVVAAKISMPNVENMSFAIPVNEVQKIVK DLETKGKIDYPDVGVKMKNIASLNSFERQAVKLPGKVKNGVVVDQVDNNGLADQSSLKKG DVITELDGKLLEDDLRFRQIIFSHKDDLKSITAKIYRDGKEKEINIKLK
Uniprot No.

Target Background

Database Links

KEGG: sab:SAB0888

Protein Families
Peptidase S1C family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What are HtrA-like proteases in S. aureus and how many are encoded in its genome?

S. aureus encodes two putative HtrA-like surface proteases, referred to as HtrA1 and HtrA2, as revealed by genome analyses. These proteases belong to the highly conserved HtrA family that is present across bacteria, yeasts, plants, and humans. HtrA (high temperature requirement) proteases were first described in Escherichia coli as housekeeping proteases responsible for the degradation of periplasmic abnormal or damaged proteins produced during thermal or oxidative stress . The presence of multiple HtrA homologs in many bacterial species suggests that these surface proteases may be important for different conditions of bacterial life .

What is the primary structure of the SAB0888 HtrA-like protein?

SAB0888 is a serine protease of the HtrA family from Staphylococcus aureus strain bovine RF122/ET3-1, identified in UniProt as Q2YX06. The protein contains characteristic domains common to HtrA proteases including a trypsin-like serine protease domain with the catalytic triad (His, Asp, Ser) and at least one PDZ domain responsible for substrate recognition and regulation of protease activity . The complete protein is maintained in storage buffer containing Tris-based buffer with 50% glycerol optimized for protein stability .

How do HtrA proteases function at the molecular level?

HtrA proteases exhibit dual functionality – they possess both protease activity for degrading misfolded proteins and chaperone activity for assisting in protein folding. Interestingly, despite its efficient stress protection capabilities, HtrA1 from S. aureus displays only weak protease activity when tested against several substrates in heterologous expression systems like Lactococcus lactis . This suggests that the chaperone activity may be a major factor in stress response protection, and that additional proteins and/or cofactors may be required for full protease activities of both HtrA1 and HtrA2 in their native environment .

How do the functions of HtrA proteases vary between different S. aureus strains?

The roles of HtrA proteins in S. aureus differ significantly according to the genetic background of the strains. Research comparing the RN6390 and COL strains demonstrates this variation clearly:

FunctionRN6390 StrainCOL Strain
Stress Resistance (HtrA1)Critical for puromycin-induced stress survivalEssential for thermal stress survival
Stress Resistance (HtrA2)Limited roleEssential for thermal stress survival
Virulence Factor ExpressionhtrA1/htrA2 double mutation affects secreted virulence factorsHtrA1 has only slight effect on exoprotein expression
agr RNA III TranscriptionAbolished in htrA1/htrA2 double mutantNot significantly affected
Virulence in Rat Endocarditis ModelDiminished in htrA1/htrA2 double mutantNo diminished virulence in htrA mutants

These strain-specific differences likely depend on specific variations in the regulation of virulence factor and stress protein expression pathways .

What experimental approaches can explain the strain-specific differences in HtrA function?

To investigate strain-specific differences, researchers have constructed htrA1, htrA2, and htrA1/htrA2 insertion mutants in genetically different virulent strains. The methodology involves:

  • Amplification of an internal fragment of the target gene (htrA1 or htrA2)

  • Insertion of antibiotic resistance markers (e.g., chloramphenicol resistance for htrA1, spectinomycin resistance for htrA2)

  • Use of temperature-sensitive plasmids like pMAD containing β-galactosidase genes for easy detection of transformants

  • Selection of double-crossover mutants through antibiotic resistance and β-galactosidase activity

  • Confirmation of gene inactivation through PCR and Southern blotting

This systematic approach allows for precise genetic manipulation and subsequent phenotypic analysis of the resulting mutants in different strain backgrounds.

How do HtrA-like proteases contribute to S. aureus stress resistance?

HtrA proteases contribute significantly to S. aureus stress resistance by:

  • Degrading abnormal or damaged proteins produced during thermal stress

  • Providing chaperone activity at low growth temperatures, similar to HtrA in E. coli which exhibits chaperone function at low temperatures and protease activity at elevated temperatures

  • Protecting against puromycin-induced stress, particularly in the case of HtrA1 in strain RN6390

  • Enabling survival under thermal stress, with both HtrA1 and HtrA2 being essential in the COL strain context

This stress resistance function appears to be a conserved role across bacterial species, but the relative contributions of HtrA1 versus HtrA2 vary depending on the specific S. aureus strain background.

What is the connection between HtrA proteases and virulence regulation?

HtrA proteases influence S. aureus virulence through several mechanisms:

  • Control of agr-dependent regulation: In the RN6390 strain, HtrA1/HtrA2 double mutation results in the disappearance of the agr RNA III transcript, which is critical for modulating the production of extracellular proteins

  • Post-translational control of surface proteins linked to biofilm formation and immune evasion

  • Influence on the expression of secreted virulence factors including hemolysins

  • Potential role in folding and/or maturation of surface components of the agr system

The agr system comprises genes expressed from two divergent transcripts. RNA II encodes AgrA, AgrB, AgrC, and AgrD, which form the auto-inducing peptide (AIP) signaling system. RNA III modulates the production of S. aureus extracellular proteins at both transcriptional and post-transcriptional levels .

What are the optimal conditions for expressing and purifying recombinant S. aureus HtrA proteins?

For successful expression and purification of recombinant S. aureus HtrA proteins:

  • The genes should be cloned into appropriate expression vectors with temperature-inducible or IPTG-inducible promoters

  • Expression can be performed in E. coli or other heterologous systems, though E. coli may require optimization due to potential toxicity of the protease activity

  • Use of affinity tags (His-tag, GST-tag) facilitates purification while maintaining protein function

  • Storage in Tris-based buffer with 50% glycerol helps maintain stability during extended storage at -20°C or -80°C

  • For functional studies, expression systems using conditional promoters (as used for HtrA1 and HtrA2 expression in L. lactis) may provide better control over potentially toxic protease activity

How can researchers accurately measure HtrA protease activity?

To effectively measure HtrA protease activity:

  • Use fluorogenic peptide substrates specific for serine proteases

  • Employ protein substrates such as β-casein, which can reveal broader substrate specificity

  • Test activity across a range of temperatures (25-45°C) to determine temperature dependency

  • Evaluate both protease and chaperone activities separately through specialized assays

  • Consider that HtrA1 from S. aureus displays only weak protease activity against several standard substrates, suggesting that additional co-factors may be required for full activity in vivo

It's important to note that HtrA proteins may have different substrate preferences and activity profiles, and both the protease and chaperone functions should be assessed to understand their full biological roles.

How can recombinant HtrA proteases be used to study S. aureus pathogenesis?

Recombinant HtrA proteases serve as valuable tools for studying S. aureus pathogenesis through:

  • Structure-function analysis to identify critical domains for protease/chaperone activities

  • In vitro processing assays to identify potential virulence factor substrates

  • Complementation studies in htrA mutant strains to confirm functional roles

  • Development of specific inhibitors to disrupt bacterial stress response pathways

  • Use as antigens in ELISA assays for detecting S. aureus infections

Additionally, understanding the strain-specific functions of HtrA proteases provides insight into how S. aureus adapts to diverse host environments and stressors during infection.

What methodological approaches best characterize the dual protease/chaperone activities of HtrA?

To characterize the dual protease/chaperone activities of HtrA:

  • Temperature-dependent assays: Measure protease activity at elevated temperatures and chaperone activity at lower temperatures

  • Site-directed mutagenesis of the catalytic triad to create protease-deficient variants that retain chaperone function

  • Protein folding assays using model substrates like citrate synthase or lysozyme to assess chaperone activity

  • Structural analysis through X-ray crystallography or cryo-EM to visualize the conformational changes associated with the transition between protease and chaperone states

  • In vivo complementation studies comparing wild-type HtrA with protease-deficient or chaperone-deficient variants

These approaches allow researchers to dissect the relative contributions of protease versus chaperone activities to HtrA function in different physiological contexts.

What are effective methods for creating htrA mutants in S. aureus?

Creating htrA mutants in S. aureus requires strategic approaches that account for the genetic manipulability of this pathogen:

  • Gene interruption through antibiotic resistance cassette insertion: Internal fragments of htrA1 or htrA2 can be interrupted by resistance markers like cat (chloramphenicol) or spc (spectinomycin)

  • Temperature-sensitive plasmids: Vectors like pMAD contain thermosensitive origins of replication and reporter genes (β-galactosidase) that facilitate identification of double-crossover events

  • Allelic replacement: The native gene can be replaced with a mutated version carrying specific point mutations or deletions

  • Confirmation methods: PCR and Southern blotting should be used to verify successful mutation

The detailed protocol for creating htrA1::cat and htrA2::spc mutants (as described in search result ) provides a robust framework for generating single and double mutants in different S. aureus genetic backgrounds.

How can researchers design experiments to investigate the relationship between HtrA and the agr regulatory system?

To investigate the relationship between HtrA and the agr regulatory system:

  • Northern blot analysis to measure agr RNA II and RNA III transcript levels in wild-type versus htrA mutant strains

  • Reporter gene fusions (using luciferase or β-galactosidase) to monitor agr promoter activity

  • Co-immunoprecipitation studies to identify potential interactions between HtrA and agr system components

  • Protein stability assays to determine if HtrA influences the turnover of AgrA, AgrB, AgrC, or AgrD proteins

  • Site-directed mutagenesis of potential HtrA recognition sites in agr components followed by functional assays

These approaches can help elucidate whether HtrA proteins act directly on agr system components or influence agr regulation through indirect mechanisms.

How do S. aureus HtrA proteases compare to those in other bacterial pathogens?

HtrA proteases exhibit both conserved and species-specific features across bacterial pathogens:

  • Conservation: The core protease domain and PDZ domains are structurally conserved across species

  • Functional roles: HtrA's involvement in stress resistance is nearly universal, appearing in both gram-positive and gram-negative bacteria

  • Species differences: While E. coli HtrA functions primarily in housekeeping roles, HtrA in S. pyogenes intervenes in the processing of extracellular virulence factors and control of hemolytic activity

  • Number of homologs: Many bacteria contain multiple HtrA homologs (S. aureus has two), suggesting specialized roles for each protease under different conditions

Understanding these comparative aspects provides insight into how HtrA proteases have evolved specialized functions in different bacterial pathogens.

What can be learned from heterologous expression of S. aureus HtrA proteins in other bacteria?

Heterologous expression studies have revealed important insights:

  • When expressed in L. lactis htrA mutant strains, S. aureus HtrA1 conferred protection against thermal stress, whereas HtrA2 showed essentially no phenotype

  • Despite its effective stress protection, HtrA1 displayed only weak protease activity against standard substrates in heterologous systems

  • These observations suggest that chaperone activity may be the primary mechanism for stress protection by HtrA1

  • The limited activity in heterologous systems indicates that additional S. aureus-specific factors may be required for full protease activation

These findings highlight the importance of studying HtrA proteins both in their native context and in heterologous systems to understand their regulatory mechanisms and functional requirements.

What are promising targets for HtrA inhibitor development against S. aureus infections?

Several promising approaches for HtrA inhibitor development include:

  • Structure-based design targeting the catalytic site of the protease domain

  • Allosteric inhibitors that prevent the conformational changes required for protease activation

  • Peptide-based inhibitors that mimic natural substrates but resist cleavage

  • Small molecules that disrupt the PDZ domain-mediated substrate recognition

  • Compounds that specifically interfere with the chaperone function without affecting protease activity

Given the strain-specific roles of HtrA proteases, inhibitors that target conserved features present in both HtrA1 and HtrA2 may provide the broadest therapeutic potential against diverse S. aureus strains.

What experimental approaches can address the mechanistic relationship between HtrA proteins and biofilm formation?

To investigate the role of HtrA proteins in biofilm formation:

  • Quantitative biofilm assays comparing wild-type, htrA1, htrA2, and htrA1/htrA2 mutant strains under various environmental conditions

  • Proteomics analysis of the extracellular matrix in wild-type versus htrA mutant biofilms

  • Identification of specific surface proteins that may be HtrA substrates using mass spectrometry-based approaches

  • Confocal microscopy with fluorescent reporters to visualize biofilm architecture and extracellular matrix composition

  • Complementation studies with wild-type versus protease-deficient HtrA variants to determine the relative importance of protease versus chaperone activities in biofilm development

These approaches can help elucidate how HtrA proteins influence the complex process of biofilm formation, which contributes significantly to S. aureus virulence and antimicrobial resistance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.