Recombinant Staphylococcus aureus Serine protease htrA-like (SACOL1028)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Protein Name: Serine protease htrA-like (EC 3.4.21.-)
Gene Locus: SACOL1028
Expression Region: Amino acids 1–769

Stress Response

  • Thermal/Oxidative Stress: HtrA-like proteases degrade misfolded proteins during stress. SACOL1028 (HtrA2) complements HtrA1 in stress survival, particularly in the COL strain .

  • Puromycin Sensitivity: Inactivation of htrA1 (analogous to SACOL1028 in some strains) reduces puromycin resistance in RN6390 .

Virulence Regulation

  • Secreted Virulence Factors: Double mutants (htrA1 htrA2) in RN6390 show defective expression of hemolysins, proteases, and other agr-regulated toxins .

  • RNA III Transcript Loss: Disruption of htrA1/htrA2 abolishes the agr RNA III transcript, impairing quorum sensing .

Strain-Specific Functions

StrainPhenotype of htrA MutantsVirulence in Endocarditis Model
RN6390Loss of exoproteins, reduced stress resistance, agr dysregulationDiminished
COLThermal stress sensitivity but no significant impact on exoproteins or virulenceUnaffected

Research Use

  • ELISA Kits: Recombinant SACOL1028 is commercially available for immunoassays to study S. aureus pathogenesis .

  • Functional Studies: Used to investigate HtrA’s chaperone-protease duality and its role in agr signaling .

Key Research Findings

  1. Dual Chaperone-Protease Activity: SACOL1028 exhibits weak protease activity but strong chaperone functionality, aiding in stress survival .

  2. agr System Dependency: HtrA proteins ensure proper folding of surface components required for agr-mediated virulence regulation .

  3. Pathogenicity: In RN6390, SACOL1028 contributes to bacterial dissemination by controlling extracellular toxins .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SACOL1028; Serine protease HtrA-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-769
Protein Length
full length protein
Species
Staphylococcus aureus (strain COL)
Target Names
SACOL1028
Target Protein Sequence
MDIGKKHVIPKSQYRRKRREFFHNEDREENLNQHQDKQNIDNTTSKKADKQIHKDSIDKH ERFKNSLSSHLEQRNRDVNENKAEESKSNQDSKSAYNRDHYLTDDVSKKQNSLDSVDQDT EKSKYYEQNSEATLSTKSTDKVESTEMRKLSSDKNKVGHEEQHVLSKPSEHDKETRIDSE SSRTDSDSSMQTEKIKKDSSDGNKSSNLKSEVISDKSNTVPKLSESDDEVNNQKPLTLPE EQKLKRQQSQNEQTKTYTYGDSEQNDKSNHENDLSHHIPSISDDKDNVMRENHIVDDNPD NDINTPSLSKTDDDRKLDEKIHVEDKHKQNADSSETVGYQSQSTASHRSTEKRNISINDH DKLNGQKTNTKTSANNNQKKATSKLNKGRATNNNYSDILKKFWMMYWPKLVILMGIIILI VILNAIFNNVNKNDRMNDNNDADAQKYTTTMKNANNTVKSVVTVENETSKDSSLPKDKAS QDEVGSGVVYKKSGDTLYIVTNAHVVGDKENQKITFSNNKSVVGKVLGKDKWSDLAVVKA TSSDSSVKEIAIGDSNNLVLGEPILVVGNPLGVDFKGTVTEGIISGLNRNVPIDFDKDNK YDMLMKAFQIDASVNPGNSGGAVVNREGKLIGVVAAKISMPNVENMSFAIPVNEVQKIVK DLETKGKIDYPDVGVKMKNIASLNSFERQAVKLPGKVKNGVVVDQVDNNGLADQSGLKKG DVITELDGKLLEDDLRFRQIIFSHKDDLKSITAKIYRDGKEKEINIKLK
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase S1C family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Staphylococcus aureus Serine protease HtrA-like (SACOL1028)?

Staphylococcus aureus Serine protease HtrA-like (SACOL1028) is one of two HtrA-like surface proteases encoded in the S. aureus genome . This protein is a full-length 769 amino acid protease belonging to the HtrA family . The protein functions in stress response and virulence factor regulation, with its precise role varying between different S. aureus strains . SACOL1028 is specifically identified as HtrA (also called HtrA1 in some studies) in the COL strain of S. aureus, as shown in genome analyses . The HtrA surface protease plays a significant role in the virulence of many pathogens, primarily through its contribution to stress resistance and bacterial survival .

How does SACOL1028 differ from other HtrA-like proteases in S. aureus?

S. aureus encodes two putative HtrA-like proteases, referred to as HtrA1 (SACOL1028) and HtrA2 . Comparative analyses have revealed distinctive functional differences between these two proteases. HtrA1 demonstrates a more pronounced role in stress response compared to HtrA2 across different S. aureus strains . When expressed in heterologous systems like Lactococcus lactis, HtrA1 conferred protection against thermal stress on thermosensitive L. lactis htrA mutants, whereas HtrA2 displayed essentially no protective phenotype . Interestingly, despite its efficient stress protection capabilities, HtrA1 displayed only weak protease activity when tested against several substrates, suggesting that its chaperone activity may be a major factor in stress response protection . The two proteases also show varying impacts on virulence factor expression dependent on the genetic background of different S. aureus strains .

What is the structure and key domains of SACOL1028?

The SACOL1028 protein consists of 769 amino acids with a complete amino acid sequence as provided in the protein database . While the specific domain architecture is not explicitly detailed in the search results, HtrA-like proteases typically contain a catalytic domain with the serine protease active site and one or more PDZ domains involved in protein-protein interactions. The amino acid sequence (full sequence available in the product information) begins with: MDIGKKHVIPKSQYRRKRREFFHNEDREENLNQHQDKQNIDNTTSKKADKQIHKDSIDKH... . The protein is localized to the bacterial surface, consistent with its role in stress response and potential interactions with extracellular components . The complete sequence information is crucial for structural analyses and functional domain predictions that guide site-directed mutagenesis studies and structure-function relationships.

How can recombinant SACOL1028 be efficiently expressed and purified for research?

For efficient expression and purification of recombinant SACOL1028, researchers typically use E. coli expression systems with His-tagging for affinity purification . The full-length protein (1-769 amino acids) can be expressed with an N-terminal His tag to facilitate purification . After expression, the protein is typically purified and provided as a lyophilized powder that can be reconstituted for experimental use . For reconstitution, it is recommended to briefly centrifuge the vial prior to opening and then reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, adding glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) and aliquoting before storage at -20°C/-80°C can help maintain protein stability . Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

What experimental approaches are most effective for studying SACOL1028 function in S. aureus?

The most effective experimental approaches for studying SACOL1028 function include:

  • Gene inactivation studies: Construction of htrA1 single mutants and htrA1 htrA2 double mutants in different S. aureus genetic backgrounds (such as RN6390 and COL strains) has proven valuable for understanding the role of these proteases . These approaches have revealed strain-specific functions of SACOL1028.

  • Stress response assays: Exposing wild-type and mutant strains to various stressors (thermal stress, puromycin-induced stress) to evaluate the role of SACOL1028 in stress resistance . In particular, thermal stress survival assays have been useful in demonstrating the roles of HtrA proteases.

  • Virulence factor expression analysis: Evaluating the impact of SACOL1028 inactivation on the expression of secreted virulence factors, particularly those regulated by the agr system . This can be done through transcriptional analysis (e.g., examining agr RNA III transcript levels) and functional assays of virulence factor activity.

  • Heterologous expression systems: Using conditional expression systems in other bacterial species (such as L. lactis) to study SACOL1028 function in isolation from other S. aureus factors .

  • In vivo virulence models: Animal models such as the rat endocarditis model have been used to assess the impact of SACOL1028 inactivation on S. aureus pathogenicity .

How can researchers assess the protease activity of SACOL1028 in vitro?

Assessment of SACOL1028 protease activity in vitro requires careful experimental design due to its reported weak protease activity against standard substrates . Researchers should consider:

  • Substrate selection: Testing multiple potential substrates is crucial as HtrA1 has shown weak activity against commonly used protease substrates . Researchers might need to design custom peptide substrates based on the predicted cleavage specificity.

  • Assay conditions optimization: Varying buffer conditions, temperature, pH, and cofactors to identify optimal conditions for protease activity. The thermal stress protection role of SACOL1028 suggests that activity might be temperature-dependent .

  • Chaperone vs. protease activity assessment: Given that HtrA1's chaperone activity may be more significant than its protease activity in some contexts, assays that can distinguish between these functions are valuable . This might include protein refolding assays and protease activity assays conducted in parallel.

  • Comparative analysis: Always including appropriate controls (e.g., known active proteases, catalytically inactive SACOL1028 mutants) and comparing activity with HtrA2 to contextualize findings .

  • Detection methods: Using fluorogenic or chromogenic substrates for real-time monitoring of protease activity, or gel-based methods such as zymography for detecting activity against protein substrates.

What controls should be included when studying SACOL1028 in different S. aureus strains?

When studying SACOL1028 in different S. aureus strains, researchers should include the following controls:

  • Wild-type parent strains: Always include the unmodified parent strains (e.g., RN6390 and COL) as positive controls to establish baseline phenotypes .

  • Complemented mutants: Reintroducing the wild-type SACOL1028 gene into mutant strains to confirm that observed phenotypes are specifically due to the absence of functional SACOL1028 rather than polar effects or secondary mutations .

  • Single and double mutants: When studying HtrA proteases, including both single (htrA1 or htrA2) and double (htrA1 htrA2) mutants is crucial due to potential functional redundancy or distinct roles of these proteases .

  • Multiple genetic backgrounds: Testing mutants in different S. aureus strains (e.g., RN6390 and COL) is essential due to strain-specific effects of SACOL1028 inactivation . This approach has revealed that the roles of HtrA proteins vary according to the strain.

  • Stress conditions: Include appropriate positive controls for stress response experiments, such as known stress-sensitive strains or wild-type cells treated with stress-inducing compounds at lethal concentrations .

What are the key considerations for in vivo studies involving SACOL1028 mutants?

When designing in vivo studies with SACOL1028 mutants, researchers should consider:

  • Strain-dependent virulence effects: Research has shown that htrA mutations affect virulence differently depending on the S. aureus strain background . The RN6390 htrA1 htrA2 double mutant showed reduced virulence in a rat endocarditis model, while similar mutations in the COL strain did not diminish virulence . This strain dependency must be considered when designing and interpreting in vivo experiments.

  • Model selection: Choose appropriate animal models based on the specific aspect of S. aureus pathogenesis being studied. The rat endocarditis model has been used successfully to evaluate virulence differences , but other models may be more appropriate depending on the research question.

  • Virulence factor analysis: Before in vivo studies, characterize the expression of virulence factors in the mutant strains, as alterations in these factors (particularly those in the agr regulon) may explain virulence differences observed in vivo .

  • Bacterial load monitoring: Include methods to monitor bacterial loads in tissues to distinguish between defects in initial colonization versus subsequent bacterial growth and dissemination.

  • Complementation controls: Include complemented mutant strains in in vivo studies to confirm that virulence alterations are specifically due to SACOL1028 inactivation rather than unintended genetic changes .

How should researchers address strain-specific differences when studying SACOL1028 function?

To address strain-specific differences in SACOL1028 function, researchers should:

  • Comparative genetic analysis: Conduct comparative genomic and transcriptomic analyses of different S. aureus strains to identify genetic differences that might explain strain-specific SACOL1028 functions . This may involve examining differences in regulatory networks affecting htrA expression or function.

  • Regulatory network mapping: Investigate strain-specific differences in regulatory networks, particularly the agr system, which has been linked to HtrA function in RN6390 but shows different patterns in COL .

  • Cross-complementation studies: Perform cross-complementation experiments where the SACOL1028 gene from one strain is expressed in the mutant of another strain to determine if strain-specific functions are due to differences in the protein itself or the genetic background.

  • Standardized phenotypic assays: Develop and apply standardized assays for stress resistance, virulence factor expression, and in vivo virulence that can be consistently applied across multiple strains for direct comparison .

  • Multiple strain testing: Always include at least two genetically distinct S. aureus strains (such as RN6390 and COL) in studies to capture strain-dependent variability in SACOL1028 function . This approach revealed that HtrA1 inactivation in RN6390 resulted in puromycin sensitivity, while in COL both HtrA1 and HtrA2 were essential for thermal stress survival.

How can researchers resolve inconsistent results when studying SACOL1028 across different S. aureus strains?

When encountering inconsistent results across different S. aureus strains, researchers should:

  • Verify mutant construction: Confirm that mutations in SACOL1028 are correctly introduced and do not cause polar effects on neighboring genes . Sequence verification and RT-PCR to check expression of adjacent genes can help identify potential issues.

  • Standardize growth conditions: Ensure that all strains are grown under identical conditions, as variations in growth media, temperature, or growth phase can significantly impact stress responses and virulence factor expression .

  • Examine strain-specific regulatory differences: Investigate strain-specific differences in regulatory networks, particularly the agr system, which has been linked to differential HtrA function in different strains . RNA-seq or targeted transcriptional analysis can help identify these regulatory differences.

  • Consider genetic background effects: Acknowledge that reported inconsistencies may reflect genuine biological differences rather than experimental errors. The observed strain-specific roles of HtrA proteins likely depend on specific differences in the regulation of virulence factor and stress protein expression .

  • Use multiple experimental approaches: Apply complementary techniques to address the same research question, as different methodologies may provide consistent patterns even when specific measurements vary between strains.

What are common challenges in purifying active recombinant SACOL1028 and how can they be addressed?

Common challenges in purifying active recombinant SACOL1028 include:

  • Protein solubility issues: SACOL1028 may form inclusion bodies during expression. This can be addressed by optimizing expression conditions (temperature, induction strength), using solubility-enhancing fusion tags, or developing refolding protocols from solubilized inclusion bodies .

  • Low enzymatic activity: HtrA1 has demonstrated weak protease activity against standard substrates . Researchers can address this by:

    • Testing multiple buffer conditions to optimize activity

    • Ensuring proper protein folding through quality control steps

    • Adding potential cofactors that might be required for full activity

    • Identifying physiologically relevant substrates

  • Protein stability concerns: To maintain stability, the recombinant protein should be properly stored as aliquots with glycerol (5-50%) at -20°C/-80°C, avoiding repeated freeze-thaw cycles . Working aliquots can be maintained at 4°C for up to one week .

  • Reconstitution challenges: The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with brief centrifugation prior to opening the vial to bring contents to the bottom .

  • Functional validation: Confirm that the purified protein retains its expected functions through activity assays, comparing wild-type protein with site-directed mutants affecting the catalytic site.

How should researchers interpret contradictory findings regarding SACOL1028's role in virulence?

When faced with contradictory findings regarding SACOL1028's role in virulence, researchers should:

  • Consider strain-specific effects: Research has demonstrated that HtrA proteins have different roles in S. aureus according to the strain background . The RN6390 htrA1 htrA2 double mutant showed reduced virulence in a rat endocarditis model, while similar mutations in the COL strain did not affect virulence .

  • Examine virulence factor expression: Analyze whether contradictory virulence outcomes correlate with differences in virulence factor expression, particularly those comprising the agr regulon . The RN6390 htrA1 htrA2 mutant showed affected expression of several secreted virulence factors and disappearance of the agr RNA III transcript, which could explain reduced virulence .

  • Investigate regulatory networks: Consider that HtrA proteins may act in the agr-dependent regulation pathway by ensuring proper folding and/or maturation of surface components of the agr system . Differences in these regulatory networks between strains could explain contradictory virulence phenotypes.

  • Analyze experimental models: Different infection models may produce contradictory results due to the varying importance of specific virulence factors in different infection settings. Evaluate whether contradictory findings stem from differences in the experimental models used.

  • Consider multifactorial roles: Recognize that SACOL1028 likely has multiple functions in S. aureus biology, including stress response and virulence factor regulation . The relative importance of these functions may vary between strains and experimental conditions, leading to apparently contradictory findings.

What is currently known about the relationship between SACOL1028 and the agr regulatory system?

Current research has revealed several key insights about the relationship between SACOL1028 (HtrA1) and the agr regulatory system in S. aureus:

  • Impact on agr-regulated virulence factors: In the RN6390 strain, the htrA1 htrA2 double mutant showed affected expression of several secreted virulence factors comprising the agr regulon . This effect was correlated with the disappearance of the agr RNA III transcript in this mutant .

  • Strain-specific effects: The relationship between HtrA proteases and the agr system appears to be strain-dependent. While HtrA inactivation had pronounced effects on agr-regulated factors in RN6390, only HtrA1 had a slight effect on exoprotein expression in the COL strain .

  • Proposed mechanism: Researchers speculate that HtrA proteins act in the agr-dependent regulation pathway by ensuring proper folding and/or maturation of some surface components of the agr system . This chaperone-like function may be critical for maintaining functional agr signaling.

  • Virulence implications: The connection between HtrA proteases and the agr system has direct implications for virulence, as demonstrated by the reduced virulence of the RN6390 htrA1 htrA2 mutant in a rat model of endocarditis . This suggests that HtrA proteins contribute to pathogenicity partly through their effects on agr-regulated factors.

  • Research gaps: While a connection has been established, the exact molecular mechanisms by which HtrA proteases influence the agr system remain to be fully elucidated, representing an important area for future research.

What are promising future research directions for understanding SACOL1028 function?

Promising future research directions for understanding SACOL1028 function include:

  • Molecular mechanism clarification: Elucidating the precise molecular mechanisms by which HtrA proteases influence the agr regulatory system, potentially through proteomic approaches identifying direct interaction partners and substrates of SACOL1028 .

  • Structural biology approaches: Determining the three-dimensional structure of SACOL1028 to understand how its conformation relates to its dual chaperone and protease functions, which could guide the development of specific inhibitors.

  • Systems biology integration: Applying systems biology approaches to map the complete network of genetic and protein interactions involving SACOL1028, particularly focusing on strain-specific differences in these networks .

  • Substrate identification: Identifying the physiological substrates of SACOL1028 in different S. aureus strains, which would provide insights into its function and potentially explain strain-specific effects .

  • Therapeutic targeting potential: Evaluating whether SACOL1028 represents a viable target for novel anti-virulence therapies, particularly in strains where it plays a significant role in virulence factor expression .

  • Host-pathogen interaction studies: Investigating whether SACOL1028 directly or indirectly interacts with host factors during infection, potentially contributing to immune evasion or tissue invasion.

How might SACOL1028 research contribute to new antimicrobial strategies?

Research on SACOL1028 may contribute to new antimicrobial strategies in several ways:

  • Anti-virulence approaches: The connection between SACOL1028 and virulence factor expression, particularly through the agr system, suggests that targeting this protease could reduce S. aureus virulence without directly killing the bacteria . This anti-virulence approach might reduce selection pressure for resistance.

  • Strain-specific treatments: Understanding the strain-specific roles of SACOL1028 could lead to more personalized treatment approaches based on the molecular characteristics of infecting S. aureus strains . This might be particularly relevant for strains like RN6390 where HtrA proteases have pronounced effects on virulence.

  • Stress response disruption: Given SACOL1028's role in stress response, particularly thermal stress and puromycin-induced stress, inhibitors could potentially sensitize S. aureus to environmental stresses or conventional antibiotics .

  • Structural drug design: Detailed structural information about SACOL1028 could enable structure-based drug design to develop specific inhibitors targeting either its protease activity or its chaperone function.

  • Combination therapies: SACOL1028 inhibitors might be developed as adjunctive therapies to be used in combination with conventional antibiotics, potentially increasing efficacy against resistant strains by compromising bacterial stress responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.