Recombinant Staphylococcus aureus Serine protease htrA-like (SAOUHSC_00958)

Shipped with Ice Packs
In Stock

Description

Stress Response and Protein Quality Control

  • Compensatory Function: SAOUHSC_00958 (HtrA2) compensates for HtrA1 in strains where the latter is deleted, maintaining proteostasis during secretion stress .

  • Secretion Stress Response: Induced by inhibitors of Type I signal peptidase (SPase), suggesting a role in mitigating secretion pathway disruptions .

Virulence Regulation

  • Impact on Virulence Factors: In S. aureus strain RN6390, double deletion of htrA1 and htrA2 reduces expression of agr-regulated toxins (e.g., hemolysins) and attenuates virulence in rat endocarditis models .

  • Strain-Specific Roles: HtrA2’s contribution to virulence varies between S. aureus strains, with minimal impact in strain COL compared to RN6390 .

Genetic and Proteomic Insights

  • Secretion Induction: SAOUHSC_00958 secretion increases when SPase is inhibited by arylomycin antibiotics, highlighting its role in adaptive responses .

  • Interactions with Chaperones: Collaborates with PrsA and SAOUHSC_01761 to facilitate protein folding under secretion stress .

Phenotypic Studies

  • Stress Sensitivity: htrA2 mutants exhibit heightened sensitivity to puromycin and thermal stress in strain RN6390 but not in COL .

  • Regulatory Links: Impacts agr system activity, which controls toxin production and biofilm formation .

Future Directions

  • Therapeutic Targeting: Exploring SAOUHSC_00958 inhibition as a strategy to disrupt S. aureus stress adaptation and virulence .

  • Structural Resolution: High-resolution crystallography could clarify substrate-binding mechanisms and guide inhibitor design .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SAOUHSC_00958; Serine protease HtrA-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-769
Protein Length
full length protein
Species
Staphylococcus aureus (strain NCTC 8325)
Target Names
SAOUHSC_00958
Target Protein Sequence
MDIGKKHVIPKSQYRRKRREFFHNEDREENLNQHQDKQNIDNTTSKKADKQIHKDSIDKH ERFKNSLSSHLEQRNRDVNENKAEESKSNQDSKSAYNRDHYLTDDVSKKQNSLDSVDQDT EKSKYYEQNSEATLSTKSTDKVESTEMRKLSSDKNKVGHEEQHVLSKPSEHDKETRIDSE SSRTDSDSSMQTEKIKKDSSDGNKSSNLKSEVISDKSNTVPKLSESDDEVNNQKPLTLPE EQKLKRQQSQNEQTKTYTYGDSEQNDKSNHENDLSHHIPSISDDKDNVMRENHIVDDNPD NDINTPSLSKTDDDRKLDEKIHVEDKHKQNADSSETVGYQSQSTASHRSTEKRNISINDH DKLNGQKTNTKTSANNNQKKATSKLNKGRATNNNYSDILKKFWMMYWPKLVILMGIIILI VILNAIFNNVNKNDRMNDNNDADAQKYTTTMKNANNTVKSVVTVENETSKDSSLPKDKAS QDEVGSGVVYKKSGDTLYIVTNAHVVGDKENQKITFSNNKSVVGKVLGKDKWSDLAVVKA TSSDSSVKEIAIGDSNNLVLGEPILVVGNPLGVDFKGTVTEGIISGLNRNVPIDFDKDNK YDMLMKAFQIDASVNPGNSGGAVVNREGKLIGVVAAKISMPNVENMSFAIPVNEVQKIVK DLETKGKIDYPDVGVKMKNIVSLNSFERQAVKLPGKVKNGVVVDQVDNNGLADQSGLKKG DVITELDGKLLEDDLRFRQIIFSHKDDLKSITAKIYRDGKEKEINIKLK
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase S1C family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is SAOUHSC_00958 and how does it relate to the HtrA protease family in S. aureus?

SAOUHSC_00958 (also referred to as HtrA2) is one of two HtrA-like serine proteases encoded by S. aureus. The HtrA family proteases are surface-associated proteins involved in stress resistance and bacterial survival . In S. aureus, the two HtrA homologs (HtrA1 and HtrA2) have distinct functions that can vary between strains. According to genome analyses, both proteins are predicted to be surface-exposed proteases, though they demonstrate different localization patterns and activities .

What is the domain architecture of HtrA2 (SAOUHSC_00958)?

HtrA2 displays a tri-domain signature typical of HtrA family proteins:

  • A transmembrane domain (TM)

  • A trypsin-like serine protease (TLSP) domain

  • A C-terminal PDZ domain

Unlike some other bacterial HtrA proteins that possess two PDZ domains, HtrA2 in S. aureus contains only a single PDZ domain. Additionally, HtrA2 has a large N-terminal domain of unknown function that likely alters its cellular localization and topology compared to HtrA1 .

How is the expression of SAOUHSC_00958 regulated?

Unlike HtrA1, the expression of HtrA2 (SAOUHSC_00958) is not typically induced by cell wall active antibiotic stress and is not controlled by the VraTSR two-component sentinel system . According to Northern blot analysis, transcription of HtrA2 has been observed to be heat-inducible at 42°C, whereas HtrA1 shows constitutive expression patterns . This suggests different regulatory mechanisms for these two homologs, which may contribute to their distinct functions.

What expression systems are most effective for producing recombinant SAOUHSC_00958?

For successful expression of recombinant HtrA2 (SAOUHSC_00958), several approaches have proven effective:

Expression in E. coli systems:

  • pET-based expression systems have been used successfully for HtrA family proteins

  • Truncation of the N-terminal transmembrane domain (typically amino acids 1-30) improves solubility

  • Addition of fusion tags (His6 or GST) facilitates purification

Expression in L. lactis:
Studies have shown successful heterologous expression of HtrA2 in L. lactis strain NZ9000 ΔhtrA, which provides a gram-positive host background that may better approximate native conditions compared to E. coli systems . This approach was particularly useful for functional studies as it allowed for testing complementation of HtrA deficiency.

Cloning strategy example:
Primers CD3284F5 and CD3284R3 have been used to clone pJC057 and pJC058 expression constructs, based on previous reports of successful HtrA protein expression .

What purification methods yield the highest purity and activity of recombinant SAOUHSC_00958?

Optimal purification protocols for obtaining high-purity, active recombinant HtrA2 include:

  • Affinity chromatography:

    • Ni-NTA purification for His-tagged constructs

    • Glutathione-agarose for GST-fusion proteins

  • Secondary purification steps:

    • Ion exchange chromatography (typically using a MonoQ column)

    • Size exclusion chromatography to obtain homogeneous protein preparations

  • Buffer optimization:

    • Inclusion of divalent cations (particularly Ca²⁺) improves stability

    • pH range of 7.0-7.5 is optimal for maintaining activity

    • Addition of glycerol (10-15%) prevents aggregation during storage

For highest activity of recombinant SAOUHSC_00958, researchers should avoid denaturing conditions and maintain the protein in buffers containing appropriate cofactors.

What methods are most effective for measuring the proteolytic activity of recombinant SAOUHSC_00958?

Several validated methods for assessing proteolytic activity of recombinant HtrA2 include:

Substrate-based assays:

  • β-casein degradation assay:

    • Incubate recombinant HtrA2 with β-casein at 37°C

    • Monitor degradation via SDS-PAGE and Coomassie staining

    • Quantify band intensity to determine relative activity

  • DTT-treated (unfolded) lysozyme degradation:

    • Particularly useful when β-casein is similar in size to your recombinant construct

    • Lysozyme (14 kDa) provides a distinct molecular weight substrate

    • Remember that HtrA2 appears to preferentially degrade unfolded substrates, so DTT treatment is essential

  • Fluorogenic peptide substrates:

    • Synthetic peptides with fluorophore/quencher pairs

    • Real-time monitoring of proteolytic activity

    • Allows for quantitative kinetic analysis

Activity conditions optimization:

  • Test activity across a pH range of 6.5-8.0

  • Evaluate temperature dependence (30-42°C)

  • Assess divalent metal cation requirements (Mg²⁺, Mn²⁺, Ca²⁺)

When interpreting results, researchers should note that HtrA2 typically shows weaker proteolytic activity compared to HtrA1, suggesting its primary function may not be solely proteolytic .

How does SAOUHSC_00958 activity differ from HtrA1 activity in S. aureus?

Key differences between HtrA2 (SAOUHSC_00958) and HtrA1 activities include:

FeatureHtrA1HtrA2 (SAOUHSC_00958)
Proteolytic activityWeak but detectableEssentially no detectable proteolytic activity against common substrates
Thermal stress protectionProvides significant protectionLimited thermal stress protection
LocalizationCell surfaceDifferent cellular localization due to large N-terminal domain
Expression patternConstitutive, induced by cell wall stressHeat-inducible at 42°C, not induced by cell wall stress
Regulatory controlRegulated by VraTSR systemNot regulated by VraTSR system
Contribution to virulenceMore pronounced role in virulenceSecondary role, strain-dependent effects

Research indicates that the chaperone activity of HtrA proteins may be more important than their proteolytic activity for certain functions, particularly in stress response protection . Additionally, unlike HtrA1, HtrA2 may require specific, yet unidentified co-factors or substrates for optimal function .

What is the role of the PDZ domain in SAOUHSC_00958 substrate recognition and activity?

The PDZ domain in HtrA2 appears to play complex roles in substrate recognition and activity:

The binding specificity of the PDZ domain likely contributes to the target selectivity of HtrA2, though the detailed mechanisms remain to be fully elucidated.

How does SAOUHSC_00958 contribute to stress response in S. aureus?

The contribution of HtrA2 (SAOUHSC_00958) to stress response varies by strain:

COL strain:

  • Both HtrA1 and HtrA2 are essential for thermal stress survival

  • Double mutants show increased sensitivity to stress conditions

RN6390 strain:

  • HtrA1 has a more pronounced role in puromycin-induced stress resistance

  • HtrA2 plays a secondary role, with more subtle effects

What is the relationship between SAOUHSC_00958 and virulence in S. aureus?

The relationship between HtrA2 and virulence demonstrates significant strain-dependent variation:

In RN6390 strain:

  • The htrA1 htrA2 double mutant shows decreased expression of secreted virulence factors in the agr regulon

  • Loss of both HtrA proteins correlates with disappearance of agr RNA III transcript

  • Virulence is reduced in a rat endocarditis model

In COL strain:

  • HtrA1 shows only slight effects on exoprotein expression

  • HtrA2 has minimal impact on virulence factor production

  • HtrA mutations do not significantly diminish virulence in the rat endocarditis model

These findings suggest that HtrA2 may contribute to pathogenicity by:

  • Controlling production of extracellular factors crucial for bacterial dissemination (particularly evident in RN6390)

  • Potentially acting in the agr-dependent regulation pathway

  • Possibly ensuring proper folding/maturation of surface components of the agr system

These strain-dependent differences highlight the importance of genetic background when studying HtrA2 function in virulence.

How can contradictory findings about SAOUHSC_00958 function in different S. aureus strains be reconciled?

Reconciling contradictory findings about HtrA2 function across different strains requires consideration of several factors:

  • Genetic background differences:

    • Different strains may have altered regulatory networks

    • Strain-specific compensatory mechanisms may exist

    • Differential expression of other surface proteases could mask phenotypes

  • Experimental approaches:

    • Use parallel methodologies across strains for direct comparison

    • Perform complementation studies to confirm phenotype is due to the specific mutation

    • Consider whole genome sequencing to identify background mutations

  • Integrated analysis strategies:

    • Conduct comprehensive transcriptomic and proteomic analyses to identify strain-specific differences in gene expression networks

    • Examine post-translational modifications of HtrA proteins that may differ between strains

    • Consider environmental conditions that may differentially affect HtrA2 function between strains

Researchers should explicitly state strain background when reporting results and avoid generalizing findings from a single strain to all S. aureus.

How do mutations in the catalytic domain of SAOUHSC_00958 affect its function and bacterial physiology?

Mutations in the catalytic domain of HtrA2 provide insights into its functional mechanisms:

Serine protease catalytic triad:
The catalytic triad (with serine as the nucleophile) is essential for any residual proteolytic activity. Mutation of the catalytic serine (equivalent to S217A in C. difficile HtrA, which shares structural similarities) abolishes proteolytic activity completely . Similar mutations would be expected to eliminate HtrA2 proteolytic activity.

Physiological effects of catalytically inactive HtrA2:
Evidence from related HtrA proteins suggests that catalytically inactive versions may:

  • Accumulate to higher levels in cells compared to wild-type protein

  • Fail to complement stress sensitivity phenotypes

  • Potentially act as dominant negatives by binding substrates without processing them

Differential requirements for domains:
Studies in C. difficile HtrA (structurally similar to S. aureus HtrA) have shown that:

  • Amino acids 30-55 are critical for proteolytic activity

  • A small α-helix between amino acids 56-64 is important for function

  • The PDZ domain is not strictly required for proteolytic activity in vitro

Similar structural elements likely exist in S. aureus HtrA2 and could be targets for mutational analysis.

What experimental approaches are recommended for studying SAOUHSC_00958 interactions with host factors during infection?

To investigate interactions between HtrA2 and host factors during infection, the following approaches are recommended:

  • In vitro interaction studies:

    • Pull-down assays with recombinant HtrA2 and host proteins

    • Surface plasmon resonance to measure binding kinetics

    • Crosslinking followed by mass spectrometry to identify interaction partners

  • Cell culture models:

    • Infection of relevant cell types (e.g., endothelial cells, neutrophils) with wild-type and HtrA2-deficient S. aureus

    • Immunofluorescence microscopy to visualize HtrA2 localization during infection

    • Comparison of host cell responses (transcriptomics, cytokine production) to wild-type versus mutant bacteria

  • Animal infection models:

    • Rat endocarditis model (previously validated for studying HtrA functions)

    • Murine skin abscess model to assess local infection dynamics

    • Systemic infection models to evaluate dissemination abilities

  • Advanced molecular approaches:

    • BioID or APEX2 proximity labeling to identify proteins in close proximity to HtrA2 during infection

    • ChIP-seq to identify potential regulatory interactions affecting HtrA2 expression

    • RNA-seq of host and pathogen transcriptomes during infection stages

  • Imaging techniques:

    • Intravital microscopy to observe HtrA2-expressing bacteria during infection

    • Super-resolution microscopy to visualize HtrA2 localization on bacterial surface

    • Electron microscopy to examine ultrastructural changes in HtrA2 mutants

These approaches can provide comprehensive insights into the role of HtrA2 in host-pathogen interactions during S. aureus infection.

What considerations should guide the development of inhibitors targeting SAOUHSC_00958?

Development of inhibitors targeting HtrA2 (SAOUHSC_00958) should consider:

  • Selectivity considerations:

    • Design inhibitors that distinguish between HtrA1 and HtrA2

    • Ensure minimal cross-reactivity with human HtrA homologs

    • Consider strain-specific differences in HtrA2 structure and function

  • Target site selection:

    • The serine protease active site offers a classical target for inhibition

    • PDZ domain interfaces present alternative targeting opportunities

    • Allosteric sites may allow more selective inhibition

  • Validated screening approaches:

    • Enzymatic assays using fluorogenic substrates

    • Thermal shift assays to identify stabilizing compounds

    • Fragment-based screening to identify initial chemical matter

  • Efficacy evaluation:

    • Test in multiple S. aureus strains due to strain-dependent functions

    • Evaluate effects on stress resistance and virulence factor production

    • Assess in relevant infection models, particularly endocarditis models

  • Potential limitations:

    • Strain-dependent importance of HtrA2 may limit universal efficacy

    • Possible redundancy with HtrA1 may require dual targeting

    • As HtrA2 shows limited proteolytic activity, inhibiting this activity may have minimal effects

Given the strain-dependent roles of HtrA2, inhibitors may need to be developed as part of combination strategies rather than standalone therapeutic agents.

How might SAOUHSC_00958 contribute to vaccine development against S. aureus?

Considering HtrA2 (SAOUHSC_00958) as a vaccine antigen involves several important factors:

Research indicates that multicomponent vaccines targeting several S. aureus virulence factors simultaneously may be most effective, potentially including HtrA2 as one component .

What are the most promising areas for future research on SAOUHSC_00958?

Key areas for future SAOUHSC_00958 research include:

  • Structural biology:

    • Determine the high-resolution structure of HtrA2, particularly focusing on the large N-terminal domain

    • Investigate how the structure differs from HtrA1 and influences cellular localization

    • Examine oligomerization states and their functional significance

  • Physiological substrates:

    • Identify natural substrates of HtrA2 in S. aureus

    • Determine whether HtrA2 functions primarily as a protease or chaperone in vivo

    • Investigate potential cofactors needed for full activity

  • Regulatory networks:

    • Elucidate how HtrA2 expression is regulated in different strains

    • Investigate the heat-inducible nature of HtrA2 expression

    • Determine how HtrA2 contributes to the agr regulatory system

  • Host interactions:

    • Examine whether HtrA2 directly interacts with host factors

    • Investigate potential immunomodulatory effects

    • Determine role in specific infection contexts (biofilm, abscess, bloodstream)

  • Therapeutic targeting:

    • Evaluate HtrA2 as part of multicomponent vaccine formulations

    • Develop selective inhibitors that distinguish between HtrA1 and HtrA2

    • Exploit strain-dependent functions for tailored therapeutic approaches

These research directions would significantly advance our understanding of HtrA2 biology and its potential as a therapeutic target.

What emerging technologies could advance our understanding of SAOUHSC_00958 function?

Emerging technologies that could transform our understanding of HtrA2 include:

  • Cryo-electron microscopy:

    • Determine high-resolution structures of HtrA2 in different conformational states

    • Visualize HtrA2 interactions with substrates and binding partners

    • Examine oligomeric assemblies under physiologically relevant conditions

  • Single-cell technologies:

    • Single-cell RNA-seq to examine heterogeneity in HtrA2 expression within bacterial populations

    • Single-cell proteomics to detect HtrA2 abundance variations

    • Microfluidics-based single-cell stress response assays

  • Advanced genetic approaches:

    • CRISPR interference for tunable repression of HtrA2 expression

    • Base editing for precise introduction of point mutations

    • Transposon sequencing to identify genetic interactions with HtrA2

  • Proteomics innovations:

    • Thermal proteome profiling to identify HtrA2 substrates and interactors

    • Advanced crosslinking mass spectrometry to map protein-protein interactions

    • Degradomics approaches to define the HtrA2 substrate repertoire

  • In situ structural biology:

    • Cryo-electron tomography to visualize HtrA2 in its native cellular context

    • Live-cell super-resolution microscopy to track HtrA2 dynamics

    • Correlative light and electron microscopy to link function with ultrastructure

  • Advanced computational approaches:

    • Molecular dynamics simulations to understand HtrA2 conformational changes

    • Machine learning for predicting strain-specific functions

    • Systems biology modeling of stress response networks involving HtrA2

These technologies would provide unprecedented insights into HtrA2 function at molecular, cellular, and organismal levels.

What are the key considerations for researchers beginning work with recombinant SAOUHSC_00958?

Researchers starting work with recombinant HtrA2 (SAOUHSC_00958) should consider:

  • Expression strategy:

    • Express truncated forms lacking the transmembrane domain (amino acids 1-30) for improved solubility

    • Consider expressing in L. lactis for a more native environment

    • Include appropriate affinity tags for purification

  • Activity assessment:

    • Be aware that HtrA2 shows limited proteolytic activity against common substrates

    • Test multiple substrates, including unfolded proteins (DTT-treated lysozyme recommended)

    • Consider activity toward strain-specific substrates

  • Strain selection:

    • Work with multiple S. aureus strains, particularly RN6390 and COL, which show different HtrA2 phenotypes

    • Include appropriate controls (HtrA1 mutants, double mutants) for comprehensive analysis

    • Consider strain-specific regulatory differences

  • Experimental design:

    • Include parallel experiments with HtrA1 for comparison

    • Test under various stress conditions (heat, oxidative stress, antimicrobial peptides)

    • Investigate both proteolytic and chaperone functions

  • Structural considerations:

    • Pay attention to the large N-terminal domain unique to HtrA2

    • Consider the role of the PDZ domain in substrate recognition

    • Examine potential oligomerization states

Following these recommendations will help researchers avoid common pitfalls and produce more reliable and meaningful data when working with recombinant HtrA2.

How should researchers interpret data from SAOUHSC_00958 studies in the context of strain variability?

When interpreting data from HtrA2 studies, researchers should:

  • Avoid overgeneralization:

    • Clearly state which strain background was used

    • Recognize that findings in one strain may not apply to others

    • Consider explicit comparative studies across multiple strains

  • Address conflicting results:

    • Compare experimental conditions when evaluating contradictory findings

    • Consider genetic background differences that might explain discrepancies

    • Examine regulatory network variations between strains

  • Contextualize functional significance:

    • Assess the relative importance of HtrA2 compared to HtrA1 in your specific strain

    • Consider redundancy and compensatory mechanisms when interpreting mild phenotypes

    • Evaluate strain-specific regulatory effects on HtrA2 function

  • Design robust controls:

    • Include both single and double mutants

    • Use complementation studies to confirm phenotypes

    • Consider constructing catalytically inactive mutants (S217A equivalent) to distinguish protease vs. chaperone functions

  • Validate with clinical isolates:

    • Test key findings in recent clinical isolates, not just lab strains

    • Consider MRSA vs. MSSA backgrounds

    • Examine correlation with strain virulence potential

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.