Recombinant Staphylococcus aureus Serine protease htrA-like (SAR0992)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

SAR0992 is a serine protease belonging to the High-temperature requirement A (HtrA) family, which facilitates protein quality control under stress conditions. Key features include:

PropertyDescription
Gene locusSAR0992 (alternative designations: SAOUHSC_00958 in strain NCTC 8325)
Protein structureContains conserved catalytic serine protease domain
Host systemExpressed in E. coli
ApplicationsStudying stress response, virulence regulation, and protease activity assays

In S. aureus, HtrA-like proteases contribute to:

  • Degradation of misfolded proteins during thermal or puromycin-induced stress

  • Regulation of virulence factors (e.g., hemolysins, agr system components)

  • Bacterial survival in host environments, including iron-limited conditions

Role in Pathogenesis and Stress Adaptation

Studies on native HtrA homologs (HtrA1 and HtrA2) reveal strain-specific functions:

Key Research Findings

  • RN6390 Strain Context:

    • Double htrA1/htrA2 mutants showed abolished agr RNA III transcription and reduced virulence in rat endocarditis models .

    • Loss of extracellular virulence factors (e.g., hemolysins) impaired bacterial dissemination .

  • COL Strain Context:

    • Both HtrA1 and HtrA2 were essential for thermal stress survival, but only HtrA1 marginally affected exoprotein expression .

This functional divergence suggests SAR0992’s recombinant form could serve as a tool to dissect strain-specific HtrA roles in infection models.

Comparative Analysis of HtrA Proteases

The table below contrasts HtrA1 and HtrA2 based on studies in S. aureus strains:

FeatureHtrA1HtrA2
Stress responseCritical for puromycin-induced stress survivalMinor role in thermal stress adaptation
Virulence regulationModulates agr-dependent virulence factorsLimited impact on exoprotein expression
Phenotype in mutantsAttenuated endocarditis virulence in RN6390No significant virulence reduction in COL

Knowledge Gaps and Future Directions

Current literature lacks direct data on SAR0992’s enzymatic kinetics or structural details. Priority research areas include:

  • Elucidating its interaction with Stk1/Stp1 signaling pathways

  • Assessing its role in biofilm formation or antibiotic resistance

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SAR0992; Serine protease HtrA-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-769
Protein Length
full length protein
Species
Staphylococcus aureus (strain MRSA252)
Target Names
SAR0992
Target Protein Sequence
MDIGKKHVIPKSQYRRKRREFFHNEDREENLNQHQDKQNIDNTTSKKADKQIHKDSIDKH ERFKNSLSSHLEQRNRDVNENKAEESKSNQGSKSAYNKDHYLTDDVSKKQNSLDSVDQDT EKSKYYEQNTEATLSTNSTDKVESTDMRKLSSDKNKVGHEEQHVLSKPSEHDKETRIDFE SSRTDSDSSMQTEKIKKDSSDGNKSSNLKSEVISDKSNSVPILSESDDEVNNQKPLTLPE EQKLKRQQSQNEQTKTYTYGDSEQNDKSNHENDLSHHTPSISDDKDYVMREDHIVDDNPD NDINTPSLSKIDDDRKLDEKIHVEDKHKQNADSSETVGYQSQSSASHRSTEKRNMAINDH DKLNGQKPNTKTSANNNQKKATSKLNKGRATNNNYSAILKKFWMMYWPKLVILMGIIILI VILNAIFNNVNKNDRMNDNNDADAQKYTTTMKNANNAVKSVVTVENETSKDSSLPKDKAS QDEVGSGVVYKKSGDTLYIVTNAHVVGDKENQKITFSNNKSVVGKVLGKDKWSDLAVVKA TSSDSSVKEIAIGDSNNLVLGEPILVVGNPLGVDFKGTVTEGIISGLNRNVPIDFDKDNK YDMLMKAFQIDASVNPGNSGGAVVNREGKLIGVVAAKISMPNVENMSFAIPVNEVQKIVK ELETKGKIDYPDVGVKMKNIASLNSFERQAVKLLGKVKNGVVVDQVDNNGLADQSGLKKG DVITELDGKLLEDDLRFRQIIFSHKDDLKSITAKIYRDGKEKEINIKLK
Uniprot No.

Target Background

Database Links

KEGG: sar:SAR0992

Protein Families
Peptidase S1C family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

Expression and Purification Methods

  • What expression systems are recommended for recombinant production of S. aureus HtrA-like proteases?

    For recombinant production of S. aureus HtrA-like proteases, Escherichia coli expression systems have been successfully used in research settings. Though the search results don't specifically detail expression of HtrA proteases, they do provide insights into optimization of recombinant protein expression that would be applicable. A factorial design approach can be employed to optimize expression conditions. Based on similar recombinant protein expression studies, recommended conditions might include growth until an OD600 of 0.8 followed by induction with 0.1 mM IPTG for 4 hours at 25°C in a medium containing 5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, and 1 g/L glucose, supplemented with appropriate antibiotics like kanamycin (30 μg/mL) . This approach has yielded high levels (250 mg/L) of soluble functional recombinant protein with approximately 75% homogeneity.

  • What purification strategies yield the highest activity for recombinant HtrA-like proteases?

    Effective purification of recombinant HtrA-like proteases requires strategies that preserve their native conformation and activity. While specific purification protocols for S. aureus HtrA are not detailed in the search results, a methodological approach would include: (1) Initial capture using affinity chromatography (such as His-tag purification if the recombinant protein includes a histidine tag); (2) Intermediate purification using ion exchange chromatography to separate the target protein from contaminants with different charge properties; (3) Polishing steps using size exclusion chromatography to achieve high purity. Throughout the purification process, it's crucial to maintain conditions that preserve protein folding and activity, which may include adding stabilizing agents and maintaining appropriate pH and ionic strength. Activity assessment should be performed after each purification step using hemolytic activity assays or specific protease substrate tests to ensure the protein remains functional .

Functional Analysis and Characterization

  • How can one differentiate between the protease and chaperone activities of HtrA-like proteins experimentally?

    Differentiating between protease and chaperone activities of HtrA-like proteins requires specific experimental approaches targeting each function independently. For protease activity assessment, researchers can utilize synthetic peptide substrates containing known cleavage sequences and measure the rate of hydrolysis spectrophotometrically. Alternatively, zymography using protein substrates co-polymerized in gels can visualize proteolytic activity. To assess chaperone activity, thermal aggregation assays with model substrates like citrate synthase or luciferase can be employed, measuring the ability of HtrA to prevent aggregation under stress conditions. The research on S. aureus HtrA1 is particularly interesting in this context, as it showed significant thermal stress protection in L. lactis expression systems despite displaying only weak protease activity against tested substrates. This suggests that chaperone activity may be a major factor in stress response protection . Comparative assays under various conditions (temperature, pH, ion concentration) can help delineate the relative contribution of each function to the protein's biological role.

  • What molecular mechanisms explain the strain-specific functions of HtrA proteins in S. aureus?

    The strain-specific functions of HtrA proteins in S. aureus likely result from complex interactions between the proteases and the distinct genetic and regulatory backgrounds of different strains. Research comparing RN6390 and COL strains demonstrates this variation clearly. In the RN6390 context, HtrA1 inactivation resulted in sensitivity to puromycin-induced stress, while the double mutant (HtrA1/HtrA2) showed defects in virulence factor expression linked to the agr regulon. In contrast, in the COL strain, both HtrA1 and HtrA2 were essential for thermal stress survival, but only HtrA1 had a slight effect on exoprotein expression . These differences likely stem from strain-specific variations in: (1) Regulatory networks controlling HtrA expression and activity; (2) Post-translational modifications affecting protein function; (3) Protein-protein interactions with strain-specific partners; and (4) Differences in cell envelope composition affecting HtrA substrate accessibility. Methodologically, comparative transcriptomics and proteomics between strains, coupled with protein interaction studies and structural analysis, would help elucidate these mechanisms.

  • How do the substrate specificities of HtrA1 and HtrA2 differ, and what techniques can identify their natural substrates?

    The substrate specificities of HtrA1 and HtrA2 in S. aureus appear to differ significantly, with HtrA1 showing weak protease activity against tested substrates and HtrA2 displaying essentially no phenotype in standard assays . To comprehensively characterize their natural substrates and differences in specificity, researchers can employ several methodological approaches:

    1. Degradomics approaches: Techniques like TAILS (Terminal Amine Isotopic Labeling of Substrates) or COFRADIC (Combined Fractional Diagonal Chromatography) can identify proteolytic events in complex mixtures.

    2. Proteome-wide analyses: Comparing the proteomes of wild-type and htrA mutant strains using quantitative proteomics to identify accumulated proteins in the mutants.

    3. Peptide library screening: Using synthetic peptide libraries to determine sequence preferences around the cleavage site.

    4. Co-immunoprecipitation: Identifying proteins that interact with catalytically inactive HtrA mutants (trap mutants) that bind but do not cleave substrates.

    5. In vitro reconstitution experiments: Testing purified candidate substrates with recombinant HtrA proteins under various conditions.

    These approaches would help elucidate not only the specific substrates of each protease but also the contextual factors that influence their activity in different S. aureus strains.

Role in Pathogenesis and Virulence

  • What is the relationship between HtrA protease activity and the agr regulon in S. aureus virulence?

    The relationship between HtrA protease activity and the agr (accessory gene regulator) regulon in S. aureus virulence appears to be significant, particularly in certain genetic backgrounds. In the RN6390 strain, the htrA1 htrA2 double mutant displayed a general defect in the expression of secreted virulence factors comprising the agr regulon. This observation correlated with the disappearance of the agr RNA III transcript in the double mutant . The agr system is a quorum-sensing system that regulates the expression of numerous S. aureus virulence factors, including hemolysins, proteases, and toxins.

    The molecular mechanism linking HtrA proteases to agr function may involve:

    1. Proper folding and/or maturation of surface components of the agr system through HtrA's chaperone activity

    2. Potential processing of agr signaling molecules or receptors

    3. Indirect effects through stress response pathways that influence agr expression

    This connection explains why the RN6390 htrA1 htrA2 mutant showed diminished virulence in a rat model of endocarditis, while surprisingly, the htrA mutations did not diminish virulence in the COL strain in the same model . These findings suggest that HtrA proteins contribute to pathogenicity in a strain-specific manner, potentially through their influence on the agr-dependent regulation pathway.

  • How can genetic manipulation techniques be optimized for studying HtrA functions in S. aureus?

    Optimizing genetic manipulation techniques for studying HtrA functions in S. aureus requires strategic approaches due to the complexity of these proteases and their strain-specific effects. Based on successful methodologies described in the literature , the following optimized approach is recommended:

    1. Gene interruption strategy: For htrA1, an internal fragment (~1.1 kb) can be amplified and interrupted with an antibiotic resistance marker (e.g., chloramphenicol resistance cat gene). For htrA2, creating an internal deletion (~955 bp) replaced with a spectinomycin resistance marker (spc) has proven effective.

    2. Vector selection: Using temperature-sensitive vectors like pMAD facilitates selection of double-crossover events.

    3. Transformation protocol: Electroporation into an intermediate S. aureus strain (like RN4220) followed by phage transduction into the target strain improves efficiency.

    4. Selection conditions: Growth at permissive temperature (30°C) with antibiotic selection followed by shift to non-permissive temperature (42°C) without selection promotes double-crossover events.

    5. Verification methods: PCR verification of correct insertion coupled with Southern blot analysis provides confirmation of genetic alterations.

    6. Complementation strategy: In trans complementation using plasmids with inducible promoters allows for controlled expression studies.

    7. Strain consideration: Given the strain-specific effects observed with HtrA proteases, parallel studies in multiple genetic backgrounds (e.g., RN6390 and COL strains) is strongly recommended to capture the range of potential phenotypes.

    This methodological approach enables comprehensive functional analysis of HtrA proteases in various S. aureus genetic backgrounds.

  • What experimental models best demonstrate the contribution of HtrA proteases to S. aureus pathogenesis?

    The optimal experimental models for demonstrating HtrA proteases' contribution to S. aureus pathogenesis should encompass both in vitro and in vivo approaches that capture the diverse roles of these proteins in stress response and virulence. Based on research findings, the following models are recommended:

    1. In vivo models:

      • Rat endocarditis model: This has successfully demonstrated reduced virulence of the RN6390 htrA1 htrA2 double mutant, making it valuable for assessing systemic infection and cardiac pathology .

      • Murine infection models: Subcutaneous abscesses, pneumonia, and bacteremia models would provide insights into tissue-specific roles of HtrA proteases.

    2. In vitro models:

      • Stress resistance assays: Testing growth under various stressors (thermal stress, oxidative stress, puromycin-induced stress) reveals the role of HtrA in bacterial survival .

      • Virulence factor expression analysis: Measuring hemolytic activity and other secreted virulence factors provides insight into the regulatory impact of HtrA on pathogenesis mechanisms.

      • Host cell interaction models: Invasion and survival assays with relevant host cell types (epithelial cells, endothelial cells, phagocytes) can demonstrate the importance of HtrA during host-pathogen interactions.

    3. Ex vivo models:

      • Whole blood survival assays: These evaluate bacterial persistence in a complex host environment.

      • Tissue explant models: Using relevant tissues can provide insights into tissue-specific aspects of pathogenesis.

    Importantly, these models should be applied across different S. aureus genetic backgrounds (particularly RN6390 and COL strains) to account for the strain-specific effects of HtrA proteases on virulence . This comprehensive approach would provide a more complete understanding of how these proteases contribute to S. aureus pathogenesis.

Experimental Design Considerations

  • What statistical approaches are most appropriate for analyzing the strain-dependent effects of HtrA mutations?

    When analyzing strain-dependent effects of HtrA mutations in S. aureus, robust statistical approaches are essential to account for biological variation and complex interactions. Based on experimental design principles and the nature of HtrA research, the following statistical methodologies are recommended:

    1. Factorial experimental designs: As demonstrated in recombinant protein expression optimization studies , factorial designs allow evaluation of multiple variables and their interactions simultaneously. For HtrA studies across different strains, a factorial approach enables systematic assessment of strain background effects, specific HtrA mutations (HtrA1, HtrA2, or double mutants), and environmental conditions.

    2. Mixed-effects models: These models account for both fixed effects (strain, mutation, condition) and random effects (biological replicates, experimental batches), providing a comprehensive statistical framework for complex datasets.

    3. Multiple testing correction: When analyzing multiple phenotypes across different strains and conditions, correction methods such as false discovery rate (FDR) control (as employed in the Mendelian randomization studies cited ) are essential to avoid false positives.

    4. Regression analysis for dose-dependent effects: For quantitative phenotypes like stress resistance or virulence factor expression, regression models can quantify the relationship between HtrA function and phenotypic outcomes across strains.

    5. Survival analysis: For virulence studies in animal models, Kaplan-Meier curves with log-rank tests provide robust comparison of strain-dependent effects on pathogen virulence.

    6. Multivariate analyses: Principal component analysis (PCA) or hierarchical clustering can identify patterns in complex phenotypic data, potentially revealing strain-specific HtrA functional clusters.

    Implementation of these approaches should include power calculations to ensure sufficient sample sizes for detecting strain-dependent effects while minimizing animal use in accordance with ethical guidelines.

  • How should researchers address contradictory findings when studying HtrA function across different S. aureus strains?

    Addressing contradictory findings when studying HtrA function across different S. aureus strains requires a systematic methodological approach that embraces rather than dismisses strain variability. Based on the observed strain-specific differences between RN6390 and COL , researchers should:

    1. Establish a strain characterization framework: Before comparing HtrA function, thoroughly characterize baseline differences in genetic background, virulence factor expression, and stress responses between strains. This provides context for interpreting seemingly contradictory results.

    2. Employ parallel experimental design: Conduct identical experiments simultaneously across multiple strains under standardized conditions to directly compare responses, as was done with RN6390 and COL strains in the endocarditis model .

    3. Utilize genomic and transcriptomic profiling: Whole genome sequencing and RNA-seq analysis can identify genetic determinants underlying strain-specific HtrA functions, potentially explaining contradictory phenotypes.

    4. Investigate regulatory network differences: Examine strain-specific differences in regulatory networks that interact with HtrA function, particularly the agr system that showed differential responses between strains .

    5. Perform complementation studies: Cross-complementation experiments (expressing HtrA from one strain in the mutant of another) can reveal whether contradictory findings stem from differences in the HtrA proteins themselves or their genetic context.

    6. Develop synthetic biology approaches: Reconstructing minimal systems with defined components from different strains can isolate variables contributing to contradictory findings.

    7. Meta-analysis methodology: When sufficient data exists across multiple strains, formal meta-analysis techniques can identify patterns explaining strain-specific differences.

    By implementing these approaches, researchers can transform contradictory findings into valuable insights about the context-dependent functions of HtrA proteases in S. aureus pathophysiology.

  • What controls are essential when assessing HtrA protease activity in different experimental settings?

    When assessing HtrA protease activity in different experimental settings, implementing comprehensive controls is crucial for obtaining reliable and interpretable results. Essential controls include:

    1. Genetic controls:

      • Wild-type strain: The parental strain without any modifications serves as the baseline.

      • Single mutants: Individual htrA1 and htrA2 mutants help distinguish the contribution of each protease .

      • Double mutant: The htrA1 htrA2 double mutant reveals potential compensatory or synergistic effects .

      • Complemented strains: Mutant strains with restored gene expression confirm phenotype specificity to the targeted gene.

      • Catalytic mutants: Strains expressing HtrA with mutations in the catalytic triad distinguish between protease and chaperone activities.

    2. Biochemical controls:

      • Protease inhibitors: Specific serine protease inhibitors confirm activity is due to HtrA rather than other proteases.

      • Heat-inactivated samples: Confirm that activity is due to enzymatic rather than non-specific effects.

      • Substrate controls: Include both known HtrA substrates and negative control substrates unlikely to be cleaved.

      • Positive control proteases: Well-characterized proteases with known activity provide reference points.

    3. Environmental controls:

      • Temperature range: Given HtrA's role in thermal stress protection, activity should be assessed at physiological and stress temperatures .

      • pH gradient: Establishing pH dependence of activity helps characterize enzyme properties.

      • Growth phase standardization: Activity can vary with bacterial growth phase, requiring standardized collection points.

    4. Analytical controls:

      • Standard curves: For quantitative assays, include standard curves using purified enzymes or products.

      • Technical replicates: Minimize measurement error.

      • Biological replicates: Account for natural biological variation.

      • Cross-strain validation: Given strain-specific effects , confirm findings across multiple S. aureus genetic backgrounds.

    Implementing these controls enables accurate characterization of HtrA protease activity and facilitates comparison between different experimental settings and S. aureus strains.

Therapeutic and Vaccine Development Implications

  • How might targeting HtrA proteases contribute to novel anti-staphylococcal therapeutic strategies?

    Targeting HtrA proteases offers promising avenues for novel anti-staphylococcal therapeutic strategies, based on their critical roles in stress resistance and virulence. Several methodological approaches could be developed:

    1. Small molecule inhibitors: Designing specific inhibitors targeting the protease active site of HtrA proteins could compromise bacterial stress tolerance. Given that both HtrA1 and HtrA2 were essential for thermal stress survival in the COL strain , such inhibitors could potentially reduce bacterial persistence during infection.

    2. Peptide-based inhibitors: Developing peptides that mimic natural substrates but contain non-cleavable bonds could competitively inhibit HtrA function. These might be particularly effective given the observed weak protease activity of HtrA1 and minimal activity of HtrA2 .

    3. Targeting protein-protein interactions: Compounds disrupting interactions between HtrA and components of the agr system could attenuate virulence in strains like RN6390, where HtrA proteins appear to influence agr-dependent virulence factor expression .

    4. Anti-chaperone strategies: Since chaperone activity appears to be a major factor in stress response protection by HtrA1 , developing compounds that interfere with this function could sensitize bacteria to host-induced stress.

    5. Strain-specific approaches: Given the strain-dependent differences in HtrA function , diagnostic tools identifying specific strain backgrounds could guide selection of appropriate HtrA-targeting therapeutics.

    6. Combination therapies: HtrA inhibitors could potentially sensitize S. aureus to conventional antibiotics by compromising stress response mechanisms, offering synergistic treatment options.

    The methodological development of these approaches would require structural studies of S. aureus HtrA proteins, high-throughput screening platforms, and in vivo validation in relevant infection models that account for strain-specific effects.

  • What considerations should guide the development of HtrA-based vaccine candidates against S. aureus?

    Developing HtrA-based vaccine candidates against S. aureus requires careful consideration of several factors to maximize efficacy and address the challenges of S. aureus immunization. Key methodological considerations include:

    1. Antigen conservation and expression: HtrA proteases show promising vaccine potential due to their conservation across S. aureus strains, similar to pneumolysin in Streptococcus pneumoniae vaccines . Analysis should confirm conservation of epitopes across clinically relevant S. aureus lineages.

    2. Strain variation effects: Given the demonstrated strain-specific functions of HtrA proteins , vaccine development should account for potential antigenic variation and different expression levels across strains.

    3. Immunogenic epitope selection: Computational and experimental epitope mapping should identify regions that:

      • Are surface-exposed and accessible to antibodies

      • Are conserved across strains

      • Elicit neutralizing antibodies that inhibit HtrA function

      • Are not subject to immune evasion mechanisms

    4. Protein engineering approaches: Consider developing recombinant constructs that:

      • Contain multiple epitopes from HtrA1 and HtrA2

      • Include inactive mutants to avoid potential toxicity

      • Incorporate appropriate adjuvants or carrier proteins

      • Are optimized for stability and immunogenicity

    5. Expression system optimization: As demonstrated in recombinant protein studies , factorial design approaches can optimize expression conditions for vaccine production, ensuring proper folding and epitope presentation.

    6. Evaluation in diverse infection models: Testing vaccine candidates in multiple infection models that reflect different aspects of S. aureus pathogenesis is crucial, particularly given the differential effects of HtrA mutations on virulence in the endocarditis model depending on strain background .

    7. Combination vaccine strategy: Given the complex pathogenesis of S. aureus, combining HtrA antigens with other conserved protective antigens may provide broader protection than single-antigen approaches.

    These methodological considerations would guide a systematic approach to developing effective HtrA-based vaccines against S. aureus infections.

Advanced Analytical Techniques

  • How can proteomics approaches be optimized to identify the complete spectrum of HtrA substrates in S. aureus?

    Optimizing proteomics approaches to identify the complete spectrum of HtrA substrates in S. aureus requires integrating multiple advanced analytical techniques. A comprehensive methodological framework would include:

    1. Comparative secretome analysis:

      • Compare extracellular proteomes of wild-type, htrA1, htrA2, and double-mutant strains using high-resolution mass spectrometry

      • Quantify proteins using SILAC (Stable Isotope Labeling with Amino acids in Cell culture) or TMT (Tandem Mass Tag) labeling to identify differentially abundant proteins

      • Analyze across multiple growth conditions that activate HtrA activity (thermal stress, oxidative stress)

    2. Degradomics approaches:

      • Apply N-terminomics techniques like TAILS (Terminal Amine Isotopic Labeling of Substrates) to identify protein cleavage events specific to HtrA activity

      • Utilize active-site directed probes specific for serine proteases to enrich for HtrA-associated substrates

      • Implement PICS (Proteomic Identification of Cleavage Sites) methodology to determine cleavage site specificity

    3. Interaction proteomics:

      • Use catalytically inactive "trap" mutants of HtrA1 and HtrA2 that bind but do not cleave substrates

      • Perform co-immunoprecipitation followed by mass spectrometry to identify interacting proteins

      • Apply proximity labeling approaches like BioID or APEX to identify transient interactions in the native cellular environment

    4. Strain-specific analysis:

      • Given the strain-specific effects of HtrA proteases , perform parallel analyses in multiple S. aureus backgrounds (RN6390, COL)

      • Use network analysis to identify strain-specific substrate patterns

    5. Validation pipeline:

      • Validate candidate substrates using in vitro cleavage assays with purified recombinant HtrA and substrate proteins

      • Confirm physiological relevance using targeted proteomics approaches (MRM/PRM) to quantify specific cleavage events during infection

    6. Data integration framework:

      • Develop computational pipelines to integrate multiple proteomics datasets

      • Apply machine learning algorithms to predict additional potential substrates based on identified cleavage patterns

    This comprehensive methodological approach would enable researchers to define the complete HtrA degradome in S. aureus and understand its contribution to bacterial physiology and pathogenesis.

  • What structural biology techniques would best elucidate the conformational changes in HtrA proteases during activation?

    Elucidating the conformational changes in HtrA proteases during activation requires an integrated structural biology approach using multiple complementary techniques. The optimal methodological strategy would include:

    1. X-ray crystallography:

      • Solve structures of S. aureus HtrA1 and HtrA2 in different states:

        • Inactive/resting state

        • Substrate-bound state

        • Active conformation

      • Use structure-based drug design to develop potential inhibitors targeting activation mechanisms

    2. Cryo-electron microscopy (Cryo-EM):

      • Visualize the entire HtrA oligomeric complex in different functional states

      • Capture transitional conformations during activation that may be difficult to crystallize

      • Analyze higher-order assemblies and potential interactions with membrane components

    3. Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

      • Map regions undergoing conformational changes during activation in solution

      • Identify allosteric sites and dynamic regions involved in the transition between inactive and active states

      • Compare dynamics between HtrA1 and HtrA2 to understand functional differences

    4. FRET-based approaches:

      • Engineer fluorescent protein pairs or dyes at strategic positions to monitor distance changes during activation

      • Perform real-time monitoring of conformational changes in response to different stimuli (temperature, substrate presence)

    5. Nuclear Magnetic Resonance (NMR) spectroscopy:

      • Analyze structural dynamics of specific domains (PDZ, protease domain) in solution

      • Investigate interactions with peptide substrates and allosteric regulators

      • Study temperature-dependent conformational changes relevant to the thermal stress response function

    6. Molecular dynamics simulations:

      • Integrate experimental structural data into computational models

      • Simulate activation pathways and energetics of conformational transitions

      • Identify potential sites for rational design of inhibitors targeting activation mechanisms

    7. Single-molecule techniques:

      • Apply optical tweezers or atomic force microscopy to analyze individual protease molecules during substrate processing

      • Characterize force-dependent aspects of protease activity relevant to its surface localization

    By integrating data from these complementary approaches, researchers could develop a comprehensive model of HtrA activation mechanisms, potentially revealing why HtrA1 shows greater activity than HtrA2 in stress response and identifying targets for therapeutic intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.