Recombinant Staphylococcus aureus Serine protease htrA-like (SAS0955)

Shipped with Ice Packs
In Stock

Description

Protein Structure

While the specific three-dimensional structure of S. aureus HtrA1 (SAS0955) has not been fully elucidated in the provided search results, the general structural characteristics of HtrA family proteases suggest that it contains:

  1. A serine protease domain with a catalytic triad

  2. At least one PDZ domain at the C-terminus

  3. A signal peptide region for surface localization

The PDZ domains in HtrA proteases typically function in substrate recognition and regulation of protease activity, making them critical components of the protein's functional architecture . The oligomeric nature of HtrA proteases further contributes to their complex regulatory mechanisms.

Functional Roles of SAS0955 in S. aureus

SAS0955 (HtrA1) performs several crucial functions in S. aureus, ranging from stress response to virulence regulation, with varying roles depending on the specific strain background.

Stress Response Functions

One of the primary roles of SAS0955 is protecting S. aureus against various stress conditions. Research has demonstrated that HtrA1 is particularly important for thermal stress survival, with htrA1 inactivation resulting in increased sensitivity to heat stress . Additionally, in the RN6390 strain context, htrA1 inactivation resulted in sensitivity to puromycin-induced stress, indicating its role in managing protein misfolding stress .

In the COL strain of S. aureus, both HtrA1 and HtrA2 were found to be essential for thermal stress survival, highlighting strain-specific differences in the roles of these proteases . The following table summarizes the stress response phenotypes observed in different S. aureus strains with htrA mutations:

S. aureus StrainMutationThermal Stress PhenotypePuromycin Stress Phenotype
RN6390htrA1Mild sensitivityIncreased sensitivity
RN6390htrA2Minimal effectMinimal effect
RN6390htrA1 htrA2Enhanced sensitivityEnhanced sensitivity
COLhtrA1Essential for survivalNot specified
COLhtrA2Essential for survivalNot specified
COLhtrA1 htrA2Severe growth defectNot specified

Chaperone and Protease Activities

Interestingly, when SAS0955 (HtrA1) was cloned and expressed in a Lactococcus lactis htrA mutant strain, it conferred protection against thermal stress despite displaying only weak protease activity when tested against several substrates . This observation suggests that the chaperone activity of HtrA1 may be a major factor in its stress response protection function, highlighting the protein's dual functionality .

The ATP-independent nature of HtrA proteases distinguishes them from many other quality control factors and suggests a unique mechanism of action in maintaining protein homeostasis during stress conditions . This characteristic makes SAS0955 an important component of S. aureus' ability to survive in diverse and challenging environments.

Role of SAS0955 in S. aureus Virulence and Pathogenicity

Beyond its functions in stress response, SAS0955 (HtrA1) plays significant roles in regulating virulence factor expression and contributing to S. aureus pathogenicity.

Regulation of Virulence Factor Expression

In the RN6390 strain background, the htrA1 htrA2 double mutant demonstrated a general defect in the expression of secreted virulence factors, including hemolysins . This observation was correlated with the disappearance of the agr RNA III transcript in the double mutant . The agr (accessory gene regulator) system is a major regulator of virulence gene expression in S. aureus, controlling the production of numerous extracellular proteins.

The agr system comprises genes expressed from two divergent transcripts:

  1. RNA II: encodes AgrA, AgrB, AgrC, and AgrD proteins involved in quorum sensing

  2. RNA III: modulates the production of S. aureus extracellular proteins at both transcriptional and posttranscriptional levels

The connection between HtrA proteases and the agr system suggests that SAS0955 may influence virulence through ensuring proper folding and/or maturation of surface components of the agr system . This regulatory role represents an indirect but crucial contribution to S. aureus pathogenicity.

Impact on Virulence in Animal Models

The virulence implications of SAS0955 function have been demonstrated in animal models. The RN6390 htrA1 htrA2 double mutant showed diminished virulence in a rat model of endocarditis compared to the wild type strain . This finding directly connects the functions of HtrA proteases to pathogenicity in vivo.

Interestingly, the impact on virulence appears to be strain-dependent. While the htrA mutations significantly reduced virulence in the RN6390 background, they did not diminish the virulence of the COL strain in the same rat model of endocarditis . This observation underscores the complex and strain-specific nature of virulence regulation in S. aureus, potentially reflecting differences in the baseline expression or regulation of virulence factors between strains.

Comparison with Other S. aureus Serine Proteases

While SAS0955 (HtrA1) functions as a serine protease involved in virulence, S. aureus possesses other serine proteases that contribute to pathogenicity through different mechanisms. For instance, the serine protease-like protein B (SplB) has been shown to induce proinflammatory cytokine release in primary human vascular endothelial cells . Unlike SAS0955, SplB operates by selectively cleaving and activating human proteinase-activated receptor-2 (PAR2), inducing biased signaling via specific G-protein pathways and contributing to endothelial damage .

The following table compares key characteristics of SAS0955 (HtrA1) with SplB:

CharacteristicSAS0955 (HtrA1)SplB
Protease typeHtrA family serine proteaseSerine protease-like protein
Main functionsStress response, protein quality control, virulence regulationEndothelial damage, inflammation induction
MechanismChaperone activity, regulation of agr systemPAR2 cleavage and activation
Key substratesNot specifically identified in search resultsHuman PAR2 receptor
Impact on pathogenesisInfluences secreted virulence factorsCauses microvascular leakage

This comparison highlights the diverse mechanisms by which different S. aureus serine proteases contribute to bacterial survival and pathogenicity.

Experimental Studies and Recombinant Expression of SAS0955

The study of SAS0955 (HtrA1) has been facilitated by various molecular and genetic approaches, including recombinant expression and mutant construction.

Generation of Recombinant SAS0955

Both the htrA1 and htrA2 genes from S. aureus have been successfully cloned and expressed in heterologous systems. In one study, these genes were cloned using a conditional expression system into an htrA mutant strain of Lactococcus lactis . This approach allowed researchers to assess the functional properties of the recombinant proteins in a controlled genetic background.

The recombinant expression revealed that while both HtrA1 and HtrA2 proteins could be produced, only HtrA1 (SAS0955) conferred protection against thermal stress on the thermosensitive L. lactis htrA mutant . This finding provided important insights into the functional specialization of the two HtrA-like proteases in S. aureus.

Construction and Characterization of htrA Mutants

Detailed genetic manipulation techniques have been employed to construct htrA1, htrA2, and htrA1 htrA2 insertion mutants in different S. aureus strains. The methodologies included:

  1. For htrA1 mutants: Interruption of the chromosomal htrA1 gene with a chloramphenicol resistance marker (cat)

  2. For htrA2 mutants: Interruption of the chromosomal htrA2 gene with a spectinomycin resistance marker (spc)

  3. For double mutants: Sequential integration of both resistance markers

The construction of these mutants involved PCR amplification of gene fragments, cloning into appropriate vectors, and introduction of antibiotic resistance markers through precise genetic manipulations . These mutant strains have been instrumental in elucidating the functional roles of SAS0955 in different S. aureus genetic backgrounds.

Future Research Directions and Applications

The study of SAS0955 opens several promising avenues for future research and potential applications in combating S. aureus infections.

Therapeutic Target Development

As a surface protease involved in stress survival and virulence regulation, SAS0955 represents a potential target for novel antimicrobial strategies. Inhibitors targeting this protease could potentially compromise bacterial survival under stress conditions and reduce virulence, providing a complementary approach to conventional antibiotics.

The strain-specific effects of htrA mutations on virulence suggest that such therapeutic approaches might need to consider the genetic diversity of S. aureus clinical isolates. Nevertheless, the fundamental importance of protein quality control systems in bacterial physiology makes SAS0955 an attractive target for broad-spectrum anti-staphylococcal strategies.

Recombinant Protein Applications

The successful recombinant expression of SAS0955 provides opportunities for structural studies, inhibitor screening, and immunological applications. Purified recombinant SAS0955 could be utilized in:

  1. High-throughput screening for small molecule inhibitors

  2. Structural determination through X-ray crystallography or cryo-electron microscopy

  3. Development of antibodies for diagnostic or therapeutic purposes

  4. Vaccine development targeting this surface-exposed virulence factor

Understanding Strain-Specific Virulence Mechanisms

The observation that HtrA proteins have different roles in S. aureus according to the strain background opens interesting questions about the evolution of virulence mechanisms in this pathogen. Further research into how genetic background influences the functions of SAS0955 could provide insights into the remarkable adaptability of S. aureus and its success as a human pathogen.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format we have in stock. If you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
SAS0955; Serine protease HtrA-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-769
Protein Length
full length protein
Species
Staphylococcus aureus (strain MSSA476)
Target Names
SAS0955
Target Protein Sequence
MDIGKKHVIPKSQYRRKRREFFHNEDREENLNQHQDKQNIDNTTSKKADKQIHKDSIDKH ERFKNSLSSHLEQRNRDVNENKAEESKSNQDSKSAYNRDHYLTDDVSKKQNSLDSVDQDT EKSKYYEQNSEATLSTKSTDKVESTDMRKLSSDKNKVGHEEQHVLSKPSEHDKETRIDFE SSRTDSDSSMQTEKIKKDSSDGNKSSNLKSEVISDKSNTVPKLSESDDEVNNQKPLTLPE EQKLKRQQSQNEQTKTYTYGDSEQNDKSNYENDLSHHMPSISDDKDNVMRENHIVDDNPD NDINTPSLSKTDDDRKLDEKIHVEDKHKQNADSSETVGYQSQSSASHRITEKRNNAINDH DKLNGQKPNAKTSANNNQKKATSKLNKGRATNNNYSDILKKFWMMYWPKLVILMGIIILI VILNAIFNNVNKNDRMNDNNDADAQKYTTTMKNANNTVKSVVTVENETSKDSSLPKDKAS QDEVGSGVVYKKSGDTLYIVTNAHVVGDKENQKITFSNNKSVVGKVLGKDKWSDLAVVKA TSSDSSVKEIAIGDSNNLVLGEPILVVGNPLGVDFKGTVTEGIISGLNRNVPIDFDKDNK YDMLMKAFQIDASVNPGNSGGAVVNREGKLIGVVAAKISMPNVENMSFAIPVNEVQKIVK DLETKGKIDYPDVGVKMKNIASLNSFERQAVKLPGKVKNGVVVDQVDNNGLADQSGLKKG DVITELDGKLLEDDLRFRQIIFSHKDDLKSITAKIYRDGKEKEINIKLK
Uniprot No.

Target Background

Database Links

KEGG: sas:SAS0955

Protein Families
Peptidase S1C family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the biological significance of HtrA-like proteases in S. aureus pathogenicity?

HtrA-like surface proteases play crucial roles in S. aureus virulence, primarily through their contribution to stress resistance and bacterial survival during infection. S. aureus encodes two putative HtrA-like proteases (HtrA1 and HtrA2) that have distinct but overlapping functions. These proteases contribute to pathogenicity by controlling the production of extracellular factors that are crucial for bacterial dissemination, as demonstrated in the RN6390 strain background .

HtrA proteases are hypothesized to function within the agr-dependent regulation pathway by ensuring proper folding and maturation of various surface components critical to the agr system . This regulatory system represents a key virulence mechanism in S. aureus, as it controls the expression of numerous secreted toxins and enzymes. Disruption of HtrA function can therefore have significant downstream effects on multiple virulence factors simultaneously.

How do the functions of HtrA1 and HtrA2 differ in S. aureus?

The functions of HtrA1 and HtrA2 vary significantly depending on the genetic background of the S. aureus strain. In strain RN6390, inactivation of htrA1 results in increased sensitivity to puromycin-induced stress, while the combined inactivation of both htrA1 and htrA2 affects the expression of secreted virulence factors regulated by the agr system . This double mutation correlates with the disappearance of agr RNA III transcript, suggesting these proteases influence regulatory pathways.

In contrast, in strain COL, both HtrA1 and HtrA2 are essential for surviving thermal stress, though only HtrA1 demonstrates a modest effect on exoprotein expression . Interestingly, virulence attenuation in animal models appears to be strain-dependent, with mutations showing significant effects in RN6390 but not in COL strains.

Research indicates that while both proteases share structural similarities, HtrA1 generally demonstrates more pronounced effects in stress response compared to HtrA2 across multiple strain backgrounds .

What experimental systems are suitable for studying recombinant HtrA-like proteases?

The study of recombinant HtrA-like proteases requires careful selection of expression systems. While E. coli is often used for its simplicity and cost-effectiveness, more complex expression systems may be necessary to ensure proper folding and activity of these proteases. When heterologously expressed in Lactococcus lactis htrA mutants, S. aureus HtrA1 conferred protection against thermal stress despite displaying only weak protease activity against standard substrates, suggesting that chaperone activity may be its primary function in this context .

For full-length protein expression of complex proteases like HtrA homologs, researchers should consider several expression systems including:

  • Bacterial systems (E. coli): Suitable for basic structural studies but may not reproduce all post-translational modifications

  • Yeast systems: Better for proteins requiring eukaryotic folding mechanisms

  • Insect cells: Good compromise between proper folding and reasonable yields

  • Mammalian cells: Optimal for studying proteins requiring complex folding or post-translational modifications

The selection should be based on the specific research objectives, considering factors such as protein folding capacity, required activity, timeframe, and cost constraints .

How can researchers distinguish between the protease and chaperone activities of HtrA-like proteins?

Distinguishing between the protease and chaperone activities of HtrA-like proteins requires specialized experimental approaches that can isolate these distinct functional characteristics. Research in heterologous systems has demonstrated that HtrA1 from S. aureus can provide significant stress protection despite showing only weak proteolytic activity against standard substrates, suggesting its chaperone activity may be predominant under certain conditions .

To differentiate these activities experimentally:

  • Temperature-dependent assays: HtrA proteins typically function as chaperones at lower temperatures and as proteases at higher temperatures. Researchers can exploit this by conducting parallel assays at different temperatures (e.g., 28°C vs. 42°C).

  • Site-directed mutagenesis: Create variants with mutations in the catalytic triad (typically Ser-His-Asp) that eliminate proteolytic activity while potentially preserving chaperone function. Compare these variants with wild-type proteins in both protease and stress-protection assays.

  • Domain-specific analysis: Express truncated versions containing only specific domains (protease domain versus PDZ domains) to assess their independent functions.

  • Co-factor manipulation: Since research suggests that additional proteins and/or cofactors may be required for full protease activity , experimental addition or depletion of potential cofactors can help distinguish which activity is dominant under specific conditions.

  • Substrate specificity profiling: Using diverse protein substrates in parallel with stress-protection assays can help determine correlation between proteolytic capacity and chaperone function.

When reporting results, researchers should include controls that specifically identify each activity independently rather than assuming both functions are always coupled.

What is the relationship between HtrA proteases and the agr regulatory system in S. aureus?

The relationship between HtrA proteases and the agr regulatory system represents a critical intersection in S. aureus virulence regulation. Research demonstrates that inactivation of both htrA1 and htrA2 in strain RN6390 affects the expression of secreted virulence factors comprising the agr regulon, correlating with the disappearance of the agr RNA III transcript . This suggests HtrA proteases act upstream of or within the agr signaling pathway.

The agr system in S. aureus operates through two divergent transcripts:

  • RNA II - encodes AgrA, AgrB, AgrC, and AgrD components:

    • AgrD functions as the precursor of the autoinducing peptide (AIP)

    • AgrB processes AIP for secretion

    • AgrC/AgrA form the two-component sensing system that responds to AIP

  • RNA III - the effector molecule that modulates extracellular protein production at both transcriptional and post-transcriptional levels

The current hypothesis suggests that HtrA proteins may ensure proper folding and maturation of surface components critical to the agr system . As surface proteases with both proteolytic and chaperone functions, HtrA proteins could maintain the structural integrity of membrane-associated components like AgrB or AgrC that are essential for signal transduction.

Researchers examining this relationship should consider experimental designs that:

  • Assess membrane protein stability in htrA mutants

  • Investigate direct interactions between HtrA proteins and agr components

  • Examine the impact of overexpressing HtrA proteases on agr-dependent phenotypes

A comprehensive understanding of this regulatory relationship could reveal new targets for anti-virulence therapeutics that don't directly target bacterial survival pathways.

What methodological approaches can resolve contradictions in HtrA functional studies across different S. aureus strains?

The strain-dependent variations in HtrA protease function present significant methodological challenges for researchers. The search results demonstrate that HtrA proteins have distinctly different roles depending on the genetic background, with different phenotypes observed in RN6390 versus COL strains . To resolve these contradictions, researchers should implement systematic approaches:

  • Complementary strain analysis: Always conduct parallel experiments in multiple well-characterized strains representing different lineages (minimum of 3-4 genetically diverse strains).

  • Genome-wide contextual analysis: Perform comparative genomics to identify genetic elements that differ between strains showing divergent HtrA phenotypes. This should include:

    • SNP analysis in regulatory regions affecting HtrA expression

    • Assessment of mutation rates in genes encoding HtrA interaction partners

    • Evaluation of strain-specific genetic elements that might compensate for HtrA function

  • Regulatory network mapping: Use transcriptomics and proteomics to compare the regulatory networks in different strains, focusing on:

    • Baseline differences in stress response pathways

    • Variations in agr system component expression

    • Alternative regulatory pathways that may be strain-specific

  • Standardized stress conditions: Develop a panel of standardized stress conditions (thermal, oxidative, antimicrobial) with precise parameters to allow direct comparison between results from different laboratories.

  • Heterologous expression studies: Express HtrA variants from different strains in a common genetic background to isolate intrinsic functional differences from strain context effects.

This methodological framework enables researchers to distinguish strain-specific artifacts from fundamental HtrA functions and build a more coherent understanding of how these proteases contribute to S. aureus pathogenicity across diverse clinical isolates.

How can researchers effectively quantify changes in virulence factor expression resulting from HtrA mutations?

Quantifying changes in virulence factor expression resulting from HtrA mutations requires integrative approaches that can capture both transcriptional and post-transcriptional effects. Since the RN6390 htrA1 htrA2 double mutant shows altered expression of several secreted factors within the agr regulon , researchers should implement:

  • Multi-level expression analysis:

    • RNA-sequencing for transcriptome-wide effects

    • qRT-PCR validation of specific virulence gene transcripts

    • Proteomics analysis of secreted fractions

    • Western blotting for key virulence factors

  • Temporal expression profiling:

    • Measure expression at multiple growth phases (early, mid, late exponential, and stationary)

    • Track expression changes during stress induction

    • Monitor dynamic responses following environmental perturbations

  • Functional validation assays:

    • Hemolytic activity testing on blood agar

    • Enzyme activity assays for proteases, lipases, and other secreted factors

    • Biofilm formation quantification

    • Host cell cytotoxicity measurements

  • Reporter constructs:

    • Generate transcriptional and translational fusions to reporter genes (e.g., GFP, luciferase)

    • Create reporters for agr system activity (RNAIII-reporter fusions)

    • Develop promoter-reporter systems for key virulence genes

  • In vivo validation:

    • Animal infection models assessing bacterial burden and tissue damage

    • Ex vivo tissue models to measure virulence factor production in host-relevant contexts

Table 1: Comparative Analysis of Virulence Factor Expression Methods

MethodAdvantagesLimitationsAppropriate Controls
qRT-PCRHigh sensitivity, quantitativeRNA only, post-transcriptional effects missedHousekeeping genes, RNA quality verification
RNA-seqGenome-wide, unbiasedCost, complex analysisWild-type comparison, multiple biological replicates
ProteomicsDirect protein measurementLow abundance proteins missedWild-type secretome, spiked-in standards
Reporter assaysReal-time monitoring, single-cell resolutionConstruct artifacts possiblePromoter-less controls, multiple constructs
Functional assaysDirect measure of activityLimited to specific factorsPurified enzyme standards, complemented mutants

By implementing this comprehensive analytical framework, researchers can distinguish direct effects of HtrA mutation from secondary regulatory changes, building a mechanistic understanding of how these proteases influence virulence factor expression.

What are the optimal conditions for recombinant expression and purification of active HtrA-like proteases?

Successful expression and purification of recombinant HtrA-like proteases from S. aureus requires careful optimization due to their complex structural requirements and dual protease/chaperone functions. Based on their surface localization and specialized activities, researchers should consider:

  • Expression system selection:

    • E. coli systems may be suitable for structural studies but often yield proteins with limited activity

    • Gram-positive hosts like B. subtilis or L. lactis provide a more native-like membrane environment

    • Previous studies successfully expressed S. aureus HtrA1 and HtrA2 in L. lactis, though only HtrA1 demonstrated significant activity

  • Vector design considerations:

    • Include fusion tags on both N- and C-termini to distinguish full-length proteins from truncated products

    • Optimize codon usage for the expression host

    • Consider inducible promoters for controlled expression

    • Include native signal peptides for proper membrane localization

  • Expression optimization parameters:

    • Lower growth temperatures (16-25°C) often improve proper folding

    • Extended induction periods at lower inducer concentrations

    • Addition of osmolytes or chaperone co-expression systems

    • Controlled aeration and media composition

  • Purification strategy:

    • Use graded imidazole concentrations during elution to separate truncated products

    • Consider native-like detergent micelles for membrane-associated forms

    • Implement multi-step purification including size exclusion chromatography

    • Validate activity at each purification step to ensure functionality is preserved

  • Activity preservation:

    • Include protease inhibitor cocktails excluding serine protease inhibitors

    • Maintain reducing conditions throughout purification

    • Consider purification at lower temperatures

    • Test activity immediately after purification, as storage may reduce function

Researchers should note that weak proteolytic activity observed in recombinant systems may reflect the need for additional cofactors or activation mechanisms present in the native environment .

How should researchers design in vivo experiments to assess the role of HtrA proteases in S. aureus virulence?

Designing robust in vivo experiments to assess HtrA proteases' role in S. aureus virulence requires careful consideration of strain-specific effects and appropriate model systems. Based on the search results showing strain-dependent virulence effects in endocarditis models , researchers should implement:

  • Strain selection strategy:

    • Test multiple S. aureus genetic backgrounds (minimum of 3-4 diverse lineages)

    • Include clinically relevant strains with different virulence profiles

    • Create isogenic mutants using precise genetic techniques that minimize polar effects

    • Generate complemented strains expressing wild-type HtrA from neutral genomic sites

  • Mutation design considerations:

    • Create single htrA1 and htrA2 mutants alongside double mutants

    • Engineer catalytic site mutants that maintain protein expression but lack protease activity

    • Consider domain-specific mutations separating chaperone from protease functions

    • Include reporter fusions to monitor in vivo expression during infection

  • Animal model selection:

    • Endocarditis models as previously validated

    • Systemic infection models (bacteremia)

    • Skin/soft tissue infection models

    • Osteomyelitis models

    • Consider both acute and chronic infection timepoints

  • Comprehensive readouts:

    • Bacterial burden in multiple tissues

    • Histopathological assessment of tissue damage

    • Inflammatory marker profiles

    • Survival curves with sufficient statistical power

    • In vivo expression of virulence factors

    • Bacterial stress response activation in vivo

  • Ex vivo validation:

    • Human tissue explant models

    • Primary human cell infection models

    • Whole blood survival assays

    • Phagocyte interaction studies

Table 2: Comparative Analysis of In Vivo Models for HtrA Function Assessment

ModelAdvantagesLimitationsKey Measurements
Rat endocarditisPreviously validated with HtrA mutants Technically challengingVegetative lesion burden, survival
Murine sepsisSystemic response assessmentRapid progressionBacterial clearance, cytokine profiles
Skin abscessLocalized infection, easy assessmentLimited systemic effectsAbscess size, bacterial recovery
Biofilm infectionMimics device-related infectionsStrains may vary in biofilm capacityBiofilm formation in vivo, bacterial persistence

By implementing this comprehensive approach and accounting for strain variation, researchers can develop a more nuanced understanding of HtrA proteases' role in virulence that better translates to clinical applications.

How can researchers overcome the weak proteolytic activity observed in recombinant HtrA-like proteins?

The weak proteolytic activity observed in recombinant HtrA-like proteins presents a significant challenge for researchers. Studies with S. aureus HtrA1 expressed in L. lactis showed that despite effective stress protection, it displayed minimal proteolytic activity against standard substrates, suggesting additional factors may be required for full activation . Researchers can implement several strategies to address this limitation:

  • Activation factor identification:

    • Screen for native binding partners using pull-down assays

    • Test candidate activators based on known HtrA interactions in other species

    • Assess the impact of membrane components or lipids on activity

    • Investigate small molecule modulators that might enhance activity

  • Substrate optimization:

    • Develop substrate libraries based on predicted S. aureus HtrA targets

    • Use unbiased approaches like PICS (Proteomic Identification of Cleavage Sites)

    • Design fluorogenic peptides based on predicted cleavage sites

    • Test protein substrates in partially denatured states

  • Assay condition optimization:

    • Systematically vary temperature, pH, and ionic strength

    • Include potential allosteric activators

    • Test activity in membrane-mimetic environments (liposomes, nanodiscs)

    • Evaluate the effect of mechanical stress or pressure on activation

  • Protein engineering approaches:

    • Generate constitutively active variants based on structural homology

    • Create chimeric proteins incorporating activation domains from related proteases

    • Introduce mutations that disrupt auto-inhibitory interactions

    • Develop truncated variants lacking regulatory domains

  • Alternative activity detection methods:

    • Develop more sensitive fluorescence resonance energy transfer (FRET) assays

    • Implement mass spectrometry-based detection of cleavage products

    • Use phage display to identify optimal peptide substrates

    • Develop cell-based reporter systems for protease activity

By systematically addressing these aspects, researchers can develop more effective tools for studying the proteolytic function of HtrA proteins and better understand their role in S. aureus biology and pathogenesis.

What strategies can resolve contradictory data regarding strain-specific effects of HtrA mutations?

Resolving contradictory data regarding strain-specific effects of HtrA mutations requires systematic approaches that can distinguish genetic background effects from experimental variables. The search results demonstrate significant differences in HtrA function between RN6390 and COL strains , highlighting the need for robust reconciliation strategies:

  • Genetic complementation analysis:

    • Cross-complementation by expressing HtrA variants from one strain in another

    • Integration of htrA genes at neutral sites to eliminate positional effects

    • Controlled expression using identical promoters across strains

    • Quantitative assessment of complementation efficiency

  • Regulatory context mapping:

    • ChIP-seq analysis of regulatory factors that might influence htrA expression

    • Promoter swapping experiments between strains

    • Global transcriptome comparison under identical conditions

    • Systematic mutation of candidate regulatory elements

  • Phenotypic spectrum analysis:

    • Create a standardized phenotypic assessment panel including:

      • Growth curves under multiple stress conditions

      • Proteome analysis of secreted factors

      • Virulence factor expression profiles

      • In vitro and in vivo infection assays

    • Apply this panel consistently across multiple reference strains

  • Minimum genetic determinant identification:

    • Conduct whole-genome sequencing of strains with divergent phenotypes

    • Perform targeted genetic swapping of candidate regions

    • Create hybrid strains with mixed genetic backgrounds

    • Use CRISPR-based screening to identify genetic modifiers

Table 3: Framework for Resolving Strain-Specific Contradictions

ApproachImplementationExpected OutcomeValidation Method
Cross-strain complementationExpress HtrA from strain A in strain B mutantIdentification of intrinsic protein differencesFunctional assays, expression verification
Regulatory element mappingPromoter-reporter fusions, ChIP-seqIdentification of strain-specific regulationMutagenesis of regulatory elements
Global context assessmentRNA-seq, proteomics of multiple strainsIdentification of compensatory pathwaysPathway perturbation experiments
Genetic determinant swappingDomain swapping, region replacementLocalization of strain-specific regionsPhenotypic convergence testing

By implementing this framework, researchers can systematically address contradictions and develop unified models that accommodate strain variation while identifying conserved HtrA functions relevant to pathogenesis.

What emerging technologies could advance our understanding of HtrA-like proteases in S. aureus?

Several emerging technologies show promise for significantly advancing our understanding of HtrA-like proteases in S. aureus, particularly in addressing the current challenges of weak in vitro activity and strain-specific effects :

  • Cryo-electron microscopy for structural studies:

    • Determine high-resolution structures of full-length HtrA proteases in membrane contexts

    • Visualize substrate binding and conformational changes during activation

    • Capture intermediate states in the catalytic cycle

    • Compare structures between active and inactive states

  • Advanced proteomics approaches:

    • Proximity-dependent biotinylation (BioID, TurboID) to identify interaction partners

    • APEX2-based spatial proteomics to map subcellular localization

    • Global thermal profiling to identify substrates and binding partners

    • Quantitative degradomics to identify physiological substrates

  • CRISPR-based technologies:

    • CRISPRi for temporal control of HtrA expression during infection

    • CRISPR activation systems to upregulate HtrA in specific contexts

    • Base editing for introducing precise mutations without selective markers

    • CRISPR screens to identify genetic interactions

  • Single-cell technologies:

    • Single-cell RNA-seq to identify population heterogeneity in HtrA expression

    • Time-lapse microscopy with activity-based probes

    • Correlative light-electron microscopy to visualize HtrA distribution during stress

    • Microfluidics combined with fluorescent reporters to track dynamic responses

  • Systems biology approaches:

    • Multi-omics integration across multiple strains

    • Machine learning models to predict strain-specific effects

    • Network analysis of regulatory circuits involving HtrA

    • Mathematical modeling of stress response dynamics

These technologies, particularly when applied in combination, could provide unprecedented insights into how HtrA proteases function within the complex biological context of S. aureus infection and stress response.

How might understanding HtrA protease regulation inform antimicrobial development strategies?

Understanding HtrA protease regulation could open novel pathways for antimicrobial development that target virulence and stress adaptation rather than essential cellular functions. The critical role of HtrA proteases in stress resistance and virulence regulation through the agr system suggests several potential therapeutic approaches:

  • Direct inhibition strategies:

    • Structure-based design of selective HtrA inhibitors targeting the active site

    • Allosteric inhibitors targeting regulatory domains

    • Peptide-based inhibitors derived from natural substrates

    • Covalent inhibitors targeting the catalytic serine

  • Regulatory disruption approaches:

    • Compounds targeting the HtrA-agr system interface

    • Molecules that interfere with stress-induced HtrA activation

    • Inhibitors of transcription factors controlling HtrA expression

    • RNA-based therapeutics targeting htrA mRNA

  • Sensitization strategies:

    • HtrA inhibitors as adjuvants to enhance antibiotic efficacy

    • Combination therapies targeting multiple stress response pathways

    • Host-directed therapies enhancing stress exposure for bacteria

    • Phage-based delivery of CRISPR systems targeting htrA genes

  • Biofilm disruption applications:

    • HtrA modulators affecting biofilm formation or dispersal

    • Combination with biofilm-penetrating antimicrobials

    • Surface coatings with controlled release of HtrA inhibitors

    • Enzymatic degradation of biofilm components combined with HtrA inhibition

  • Diagnostic and theranostic potential:

    • HtrA activity-based probes for infection monitoring

    • Strain typing based on HtrA variant profiles

    • Predictive diagnostics for infection severity

    • Personalized antimicrobial selection based on HtrA characterization

The strain-specific variations in HtrA function suggest that therapeutic approaches may need customization based on the predominant strains in specific clinical contexts. Multi-targeting approaches addressing both HtrA1 and HtrA2 would likely provide the most robust therapeutic strategy across diverse S. aureus lineages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.