Recombinant Staphylococcus aureus Serine protease htrA-like (SAV1023)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

SAV1023 corresponds to the htrA-encoded serine protease (SAOUHSC_00958 in strain NCTC 8325) and is part of a conserved family of heat shock-induced proteases. Key features include:

  • Domain Structure: Contains a catalytic serine protease domain and two PDZ domains for substrate recognition .

  • Stress Response: Essential for bacterial survival under thermal, oxidative, and puromycin-induced stress .

  • Post-Translational Regulation: Modulates virulence factor secretion by influencing the agr (accessory gene regulator) system .

Role in S. aureus Virulence

Experimental studies using htrA mutants in two S. aureus strains (RN6390 and COL) reveal strain-specific roles:

FunctionRN6390 StrainCOL Strain
Stress ResistanceHtrA1 critical for puromycin resistance Both HtrA1 and HtrA2 required for thermal stress
Virulence Factor SecretionDouble mutant (htrA1 htrA2) shows reduced hemolysins, proteases, and RNA III (agr transcript) Minimal impact on exoprotein expression
In Vivo PathogenicityAttenuated virulence in rat endocarditis No significant virulence reduction

These differences suggest HtrA proteases contribute to virulence through strain-specific regulatory networks, particularly in RN6390, where they stabilize agr-dependent virulence factors .

3.1. Impact on Virulence Regulation

  • In RN6390, the htrA1 htrA2 mutant exhibited:

    • Loss of RNA III (agr effector molecule), disrupting quorum sensing .

    • Reduced extracellular proteolytic activity, including V8 protease .

    • Impaired processing of nuclease (NucB to NucA), critical for immune evasion .

3.2. Stress Survival Mechanisms

  • HtrA1 in RN6390 degrades misfolded proteins under puromycin stress .

  • In COL, both HtrA1 and HtrA2 are essential for thermal stress survival, likely through protein quality control .

Applications in Vaccine Development

While SAV1023 itself is not a vaccine component, insights into HtrA’s role have informed broader strategies:

  • Vaccine Target Potential: HtrA’s involvement in virulence regulation makes it a candidate for anti-virulence therapies .

  • Adjuvant Role: Recombinant HtrA proteins could enhance antigen processing in multi-component vaccines like rFSAV (a five-antigen vaccine showing 87% survival in murine sepsis models) .

Future Research Directions

  • Mechanistic Studies: Elucidate HtrA’s interaction with agr components and host immune cells.

  • Therapeutic Exploration: Evaluate HtrA inhibitors or recombinant forms as adjuncts to antibiotics.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. You may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please communicate them to us, and we will prioritize development with the specified tag.
Synonyms
SAV1023; Serine protease HtrA-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-769
Protein Length
full length protein
Species
Staphylococcus aureus (strain Mu50 / ATCC 700699)
Target Names
SAV1023
Target Protein Sequence
MDIGKKHVIPKSQYRRKRREFFHNEDREENLNQHQDKQNIDNTTSKKADKQIHKDSIDKH ERFKNSLSSHLEQRNRDVNENKAEESKSNQDSKSAYNRDHYLTDDVSKKQNSLDSVDQDT EKSKYYEQNSEATLSTKSTDKVESTEMRKLSSDKNKVGHEEQHVLSKPSEHDKETRIDSE SSRTDSDSSMQTEKIKKDSSDGNKSSNLKSEVISDKSNTVPKLSESDDEVNNQKPLTLPE EQKLKRQQSQNEQTKTYTYGDSEQNDKSNHENDLSHHTPSISDDKDNVMRENHIVDDNPD NDINTLSLSKIDDDRKLDEKIHVEDKHKQNADSSETVGYQSQSTASHRSTEKRNISINDH DKLNGQKTNTKTSANNNQKKATSKLNKGRATNNNYSDILKKFWMMYWPKLVILMGIIILI VILNAIFNNVNKNDRMNDNNDADAQKYTTTMKNANNTVKSVVTVENETSKDSSLPKDKAS QDEVGSGVVYKKSGDTLYIVTNAHVVGDKENQKITFSNNKSVVGKVLGKDKWSDLAVVKA TSSDSSVKEIAIGDSNNLVLGEPILVVGNPLGVDFKGTVTEGIISGLNRNVPIDFDKDNK YDMLMKAFQIDASVNPGNSGGAVVNREGKLIGVVAAKISMPNVENMSFAIPVNEVQKIVK DLETKGKIDYPDVGVKMKNIASLNSFERQAVKLPGKVKNGVVVDQVDNNGLADQSGLKKG DVITELDGKLLEDDLRFRQIIFSHKDDLKSITAKIYRDGKEKEINIKLK
Uniprot No.

Target Background

Database Links

KEGG: sav:SAV1023

STRING: 158878.SAV1023

Protein Families
Peptidase S1C family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What are HtrA-like proteases in Staphylococcus aureus?

HtrA-like proteases in Staphylococcus aureus are surface proteases involved in stress resistance and bacterial survival. Genome analyses have revealed that S. aureus encodes two putative HtrA-like proteases, referred to as HtrA1 and HtrA2. These proteases play important roles in the virulence of many pathogens, primarily through their contribution to stress resistance mechanisms . The HtrA family of proteins generally exhibits both protease and chaperone activities, which facilitate proper protein folding under stress conditions. In the context of S. aureus, HtrA1 has demonstrated a more pronounced role in stress response compared to HtrA2, although their specific functions vary according to the genetic background of different S. aureus strains .

What is the genomic organization of HtrA-like proteases in Staphylococcus aureus?

The genomic organization of HtrA-like proteases in Staphylococcus aureus involves two distinct genes, htrA1 and htrA2, which encode the respective proteins. These genes are located at separate positions on the bacterial chromosome, unlike the ssp operon (which encodes another serine protease) that has a more clustered organization with genes sspA, sspB, and sspC arranged sequentially . In studies examining the functions of these proteases, researchers have constructed htrA1, htrA2, and htrA1 htrA2 insertion mutants in different S. aureus strains, typically by introducing antibiotic resistance markers into the genes . For example, in experimental constructions, the htrA1 gene (approximately 1.3 kb) has been interrupted by a chloramphenicol resistance marker (cat), while htrA2 has been disrupted using spectinomycin resistance markers . This genomic organization facilitates the independent regulation of these proteases in response to various environmental conditions.

What expression systems are typically used for recombinant production of HtrA-like proteases?

For recombinant production of HtrA-like proteases from Staphylococcus aureus, Escherichia coli expression systems are commonly employed due to their well-established protocols and high protein yields. Based on available research data, recombinant HtrA-like proteases, including SAV1023, are typically expressed as fusion proteins with affinity tags such as histidine (His) tags to facilitate purification . The full-length SAV1023 protein, consisting of 769 amino acids, has been successfully produced as a His-tagged recombinant protein, allowing for efficient purification using immobilized metal affinity chromatography .

When expressing these proteins, researchers often use inducible promoter systems such as the T7 or tac promoter, which provide tight regulation of expression. Temperature optimization is critical when expressing potentially toxic proteases, with typical induction conditions ranging from 16°C to 30°C to balance protein expression with proper folding. Additionally, protease inhibitors are frequently incorporated during purification steps to prevent self-degradation of the target protein. For functional studies, it's important to note that the activity of recombinant HtrA-like proteases may differ from their native counterparts, as demonstrated in studies where HtrA1 displayed only weak protease activity despite effective stress protection capabilities .

How are HtrA-like protease mutants created for functional studies?

Creating HtrA-like protease mutants for functional studies in Staphylococcus aureus typically involves a multi-step process of gene inactivation through insertion of antibiotic resistance markers. Based on established protocols, researchers first amplify an internal fragment of the target htrA gene using PCR with specific primers. For example, to construct an htrA1::cat mutant, a ~1.1-kb internal fragment of the htrA1 gene can be amplified from S. aureus using forward primer A1-5′ (5′-CCAAACACCTAGATACAGAAGACC-3′) and reverse primer A1-3′ (5′-CCATCACGGATAACGGTAACAG-3′) . The amplified fragment is then cloned into a suitable vector, such as pCRII-TOPO.

The resulting plasmid is modified by inserting an antibiotic resistance cassette (e.g., chloramphenicol resistance marker cat for htrA1 or spectinomycin resistance marker spc for htrA2) . The modified plasmid is then introduced into an initial S. aureus strain (typically RN4220) by electroporation. Successful transformants are selected based on their acquired antibiotic resistance and confirmed by PCR and/or Southern blotting. To transfer the mutation to virulent strains (such as RN6390 or COL), bacteriophage transduction is employed . Double mutants (htrA1 htrA2) can be created by sequential inactivation of both genes using different resistance markers. This methodical approach allows researchers to study the individual and combined roles of HtrA-like proteases in bacterial physiology and virulence.

What assays can be used to measure the protease activity of recombinant HtrA-like proteins?

Several robust assays can be employed to measure the protease activity of recombinant HtrA-like proteins from Staphylococcus aureus. Fluorogenic peptide substrates containing sequences recognized by serine proteases are commonly used for quantitative analysis. These substrates typically incorporate amino acid sequences with fluorophore and quencher pairs, where proteolytic cleavage results in increased fluorescence that can be measured spectrofluorometrically.

For more comprehensive analysis, researchers can utilize casein zymography, where the protease sample is separated on non-reducing SDS-PAGE gels containing casein as a substrate. Following electrophoresis and renaturation, proteolytic activity appears as clear zones against a stained background. Additionally, azocasein assays provide a colorimetric method for measuring protease activity, where TCA-soluble colored peptides released by proteolytic cleavage can be quantified spectrophotometrically.

It's worth noting that studies have observed varying degrees of protease activity among different HtrA-like proteins. For instance, when HtrA1 and HtrA2 from S. aureus were expressed in Lactococcus lactis, HtrA1 displayed only weak protease activity against several substrates despite conferring thermal stress protection, while HtrA2 showed essentially no detectable proteolytic activity . This suggests that their biological functions may rely more on chaperone activity than proteolytic capacity, or that additional cofactors or activation mechanisms present in S. aureus may be required for full enzymatic function.

How can the stress-protective function of HtrA-like proteases be evaluated?

The stress-protective function of HtrA-like proteases can be evaluated through several complementary approaches that assess bacterial survival and growth under various stress conditions. Growth curve analysis represents a fundamental method, where wild-type strains and htrA mutants are cultured under different stress conditions (thermal, oxidative, or antibiotic), with growth monitored by optical density measurements. For example, studies have demonstrated that htrA1 inactivation in the RN6390 strain resulted in sensitivity to puromycin-induced stress, while in the COL strain, both HtrA1 and HtrA2 were essential for thermal stress survival .

Survival assays provide more direct measurements of stress resistance by exposing bacteria to acute stress conditions (e.g., elevated temperatures, hydrogen peroxide) for defined periods, followed by plating and colony counting to determine survival rates. These assays revealed that double mutants (htrA1 htrA2) typically exhibit greater stress sensitivity than single mutants .

Complementation studies are essential for confirming phenotype specificity, involving the reintroduction of functional htrA genes into mutant strains to assess restoration of stress resistance. In heterologous expression systems, the functional roles of HtrA proteins have been demonstrated by their ability to protect other bacterial species against stress, as shown when S. aureus HtrA1 conferred protection against thermal stress when expressed in a thermosensitive Lactococcus lactis htrA mutant .

For a more comprehensive understanding, researchers can combine these approaches with transcriptomic or proteomic analyses to identify genes or proteins whose expression is affected by htrA mutations, providing insights into the broader regulatory networks influenced by these proteases.

How do HtrA-like proteases contribute to Staphylococcus aureus virulence?

HtrA-like proteases contribute to Staphylococcus aureus virulence through multiple interconnected mechanisms, primarily involving stress resistance and regulation of virulence factor expression. As surface proteases, HtrA proteins enhance bacterial survival under stress conditions encountered during infection, including temperature fluctuations, oxidative stress, and exposure to antimicrobial compounds . This stress protection function is critical for bacterial persistence within host tissues.

More significantly, HtrA proteases have been shown to influence the expression of secreted virulence factors. In the RN6390 strain, the htrA1 htrA2 double mutant exhibited a general defect in the expression of secreted virulence factors comprising the agr regulon, including hemolysins . This observation correlated with the disappearance of the agr RNA III transcript in the mutant strain. The agr (accessory gene regulator) system represents a critical virulence-associated quorum sensing mechanism in S. aureus that controls the expression of numerous exotoxins and enzymes . By influencing this regulatory pathway, HtrA proteases indirectly modulate the production of multiple virulence determinants.

The impact of HtrA proteins on virulence has been demonstrated in animal models, where the RN6390 htrA1 htrA2 mutant showed diminished virulence in a rat endocarditis model compared to the wild-type strain . Interestingly, this virulence attenuation was strain-dependent, as htrA mutations did not reduce the virulence of the COL strain in the same model, highlighting the variable roles of these proteases in different genetic backgrounds. These findings suggest that HtrA proteins contribute to pathogenicity by controlling the production of extracellular factors crucial for bacterial dissemination, potentially by ensuring proper folding and/or maturation of components within the agr regulatory system.

What is the relationship between HtrA-like proteases and the agr regulatory system?

The relationship between HtrA-like proteases and the agr regulatory system in Staphylococcus aureus represents a critical connection between stress response mechanisms and virulence regulation. Research has revealed that inactivation of both htrA1 and htrA2 genes in the RN6390 strain results in the disappearance of the agr RNA III transcript, the primary effector molecule of the agr system . This finding indicates that HtrA proteins are necessary for proper agr functionality, though the exact molecular mechanism remains to be fully elucidated.

The agr system in S. aureus comprises genes expressed from two divergent transcripts: RNA II and RNA III. RNA II encodes AgrA, AgrB, AgrC, and AgrD, which collectively form a quorum sensing mechanism. AgrD serves as the precursor of the secreted autoinducing peptide (AIP), which is processed by the transmembrane protein AgrB. When AIP reaches sufficient concentration, it activates the AgrC/AgrA two-component system, inducing transcription of both RNA II and RNA III. RNA III then modulates the production of S. aureus extracellular proteins at both transcriptional and posttranscriptional levels .

The most plausible hypothesis is that HtrA proteins, through their dual protease and chaperone activities, ensure proper folding and/or maturation of surface components critical to the agr system's functionality. For instance, they might be involved in processing or presenting AIP or ensuring the proper conformation of the AgrB, AgrC, or AgrA proteins. This hypothesis is supported by observations that HtrA1 displayed relatively weak protease activity despite efficiently protecting against thermal stress, suggesting that its chaperone function may be particularly important . The strain-specific effects of htrA mutations on virulence factor expression further indicate that the relationship between HtrA proteases and the agr system is influenced by the broader regulatory network present in different S. aureus genetic backgrounds.

How can recombinant HtrA-like proteases be utilized for developing novel antimicrobial strategies?

Recombinant HtrA-like proteases from Staphylococcus aureus present promising opportunities for developing novel antimicrobial strategies, leveraging their essential roles in bacterial stress response and virulence regulation. By producing and characterizing recombinant forms of these proteases, such as the His-tagged SAV1023 protein , researchers can conduct high-throughput screening for specific inhibitors that target their crucial functions.

Given that HtrA proteases contribute to stress resistance and virulence factor expression in S. aureus , inhibitors of these enzymes could potentially render bacteria more susceptible to environmental stresses and attenuate their virulence. This approach is particularly attractive because targeting virulence mechanisms rather than growth represents an anti-virulence strategy that may exert less selective pressure for resistance development compared to conventional antibiotics.

Recombinant HtrA-like proteases can also be employed in structural biology studies to elucidate their three-dimensional structure and catalytic mechanisms. This structural information can guide structure-based drug design efforts to develop highly specific inhibitors. Additionally, understanding the substrate specificity of these proteases through peptide library screening with recombinant enzymes could reveal critical protein-protein interactions that could be disrupted by therapeutic agents.

For vaccine development, recombinant HtrA-like proteases may serve as potential immunogens. Since these are surface-associated proteins involved in virulence, antibodies directed against them might neutralize their function and enhance bacterial clearance by the host immune system. In vitro and animal model studies using purified recombinant proteins could evaluate their immunogenicity and protective efficacy as vaccine candidates, potentially addressing the growing challenge of antibiotic-resistant S. aureus infections.

What are the technical challenges in working with recombinant HtrA-like proteases?

Working with recombinant HtrA-like proteases from Staphylococcus aureus presents several technical challenges that researchers must address to achieve successful expression, purification, and functional characterization. One primary challenge is maintaining the enzymatic activity of these proteases throughout the recombinant production process. Studies with S. aureus HtrA proteins have shown that they may display reduced protease activity when expressed in heterologous systems, as observed when HtrA1 exhibited only weak protease activity despite conferring thermal stress protection when expressed in Lactococcus lactis . This suggests that additional cofactors or specific conditions present in S. aureus may be necessary for full enzymatic function.

Protein solubility represents another significant challenge, as membrane-associated proteases like HtrA family members often contain hydrophobic domains that can cause aggregation during recombinant expression. Researchers typically address this by optimizing expression conditions (temperature, inducer concentration), using solubility-enhancing fusion tags, or expressing truncated versions that maintain catalytic activity while removing problematic domains.

Self-cleavage during expression and purification poses a particular challenge for proteases. HtrA proteases may undergo autoproteolysis, potentially reducing yield and generating heterogeneous preparations. This necessitates careful optimization of purification protocols, often incorporating protease inhibitors or engineering mutations in the active site to produce inactive variants for structural studies.

Ensuring proper folding is critical, as the dual protease and chaperone activities of HtrA proteins depend on correct tertiary structure. Experimental evidence suggests that chaperone activity may be a major factor in stress response protection by HtrA1 , underscoring the importance of maintaining native-like folding during recombinant production. Researchers may need to explore various expression systems, periplasmic targeting, or co-expression with bacterial chaperones to overcome these folding challenges and produce functionally active recombinant HtrA-like proteases for advanced research applications.

How do the functions of HtrA1 and HtrA2 differ in various Staphylococcus aureus strains?

The functions of HtrA1 and HtrA2 proteases exhibit notable strain-dependent variations in Staphylococcus aureus, highlighting the importance of genetic background in determining their physiological roles. Comparative studies using htrA1, htrA2, and htrA1 htrA2 insertion mutants in genetically distinct virulent strains, specifically RN6390 and COL, have revealed these functional differences .

In the RN6390 strain, htrA1 inactivation resulted in sensitivity to puromycin-induced stress, indicating its importance in antibiotic stress resistance. The RN6390 htrA1 htrA2 double mutant displayed a general defect in the expression of secreted virulence factors comprising the agr regulon, with a corresponding disappearance of the agr RNA III transcript . This regulatory effect translated to reduced virulence in a rat model of endocarditis for the double mutant.

Across both strains, HtrA1 consistently demonstrated a more pronounced role in stress response than HtrA2, though the double mutants exhibited slightly enhanced stress sensitivity compared to single mutants . These observations indicate that while there is some functional overlap between the two proteases, they likely have distinct preferred substrates or regulatory targets. The strain-dependent functions of these proteases likely reflect differences in the underlying regulatory architecture governing virulence factor expression, with HtrA proteins potentially operating through different molecular mechanisms depending on the specific genetic context.

What is the relationship between HtrA-like proteases and other serine proteases in Staphylococcus aureus?

Staphylococcus aureus produces several distinct families of serine proteases that collectively contribute to bacterial physiology and virulence through different mechanisms. HtrA-like proteases (HtrA1 and HtrA2) and the Ssp (Staphylococcal serine protease) family represent two significant groups with distinct structural features, substrate specificities, and biological functions.

The Ssp family includes the well-characterized V8 protease (SspA), which is encoded within an operon structure alongside sspB (encoding a 40.6-kDa cysteine protease) and sspC (encoding a 12.9-kDa protein of unknown function) . Like HtrA-like proteases, SspA has been implicated in S. aureus virulence through signature tagged mutagenesis studies, which identified it as necessary for in vivo growth and survival in multiple infection models . This parallel importance in pathogenesis suggests potential functional relationships between these protease systems, though they likely act through different mechanisms.

While HtrA-like proteases are primarily surface-associated and involved in stress response and protein quality control at the cell envelope, SspA is a secreted enzyme that degrades host proteins and modulates bacterial adhesion . The regulatory control of these proteases also differs, with HtrA proteins potentially functioning upstream in the regulatory cascade by influencing the agr system , while the ssp operon itself is regulated by the agr and sar systems .

Despite these differences, both protease families appear to contribute to the adaptive capabilities of S. aureus during infection. Their complementary functions may allow the bacterium to respond to diverse environmental challenges while precisely controlling the timing and extent of virulence factor production. Future research investigating potential cross-talk between these protease systems could reveal synergistic relationships that collectively enhance bacterial fitness during infection.

What are the most promising future research directions for HtrA-like proteases?

The study of HtrA-like proteases in Staphylococcus aureus presents several promising future research directions that could significantly advance our understanding of bacterial pathogenesis and lead to novel therapeutic strategies. One critical area for investigation is the precise molecular mechanism by which HtrA proteins influence the agr regulatory system. While current research has established that the htrA1 htrA2 double mutant in the RN6390 strain lacks agr RNA III expression , the specific protein interactions or processing events through which HtrA proteases facilitate agr functionality remain poorly understood. Advanced techniques such as protein-protein interaction studies, substrate identification through proteomic approaches, and structural analysis of HtrA-substrate complexes could elucidate these mechanisms.

The strain-specific roles of HtrA proteases represent another compelling research direction. Comparative genomic and transcriptomic analyses across diverse S. aureus lineages could identify genetic elements that determine whether HtrA proteins primarily influence stress resistance or virulence factor expression in different strains . This knowledge would enhance our understanding of how regulatory networks evolve in pathogenic bacteria and could reveal novel targets for strain-specific intervention strategies.

Developing specific inhibitors of HtrA-like proteases constitutes a promising therapeutic approach. High-throughput screening of compound libraries against recombinant HtrA proteases, such as the His-tagged SAV1023 , could identify lead molecules for further development. Structure-based drug design informed by crystallographic data would facilitate optimization of these inhibitors. Since HtrA proteins contribute to both stress resistance and virulence regulation , inhibitors might simultaneously sensitize bacteria to environmental stresses and attenuate virulence, representing a multi-pronged approach to combat S. aureus infections.

Finally, exploring the potential of HtrA proteins as vaccine candidates warrants investigation. As surface-associated proteases involved in virulence, they represent possible targets for protective antibody responses. Immunization studies using recombinant HtrA proteins in animal models could assess their protective efficacy and inform the development of novel vaccines against S. aureus, addressing an urgent need in the face of increasing antibiotic resistance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.