Recombinant Staphylococcus aureus Signal transduction histidine-protein kinase ArlS (arlS)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Staphylococcus aureus Signal Transduction Histidine-Protein Kinase ArlS (ArlS)

Staphylococcus aureus is a versatile opportunistic pathogen that adapts to different environments and stresses imposed by the host . Two-component systems like ArlRS often facilitate these adaptations . ArlS, or Signal transduction histidine-protein kinase ArlS, is a sensor histidine kinase that is part of the ArlRS two-component system in Staphylococcus aureus . In a typical two-component system, a histidine kinase and a response regulator function as a pair . ArlS has been proposed to activate ArlR in response to host-imposed manganese starvation and glucose limitation by sensing changes in the abundance of a metabolic intermediate in the latter half of glycolysis .

Function and Mechanism of ArlS

ArlS is a membrane-bound histidine kinase that contains an extracellular domain that detects an unknown signal . Upon activation, ArlS autophosphorylates a conserved histidine residue (H242), and then transfers this phosphate to an aspartate residue within ArlR (D52) . ArlR is an OmpR/PhoB-type response regulator protein that binds to DNA after being phosphorylated by ArlS . ArlS is necessary for activating ArlR in response to glucose availability, and to manganese sequestration by the host immune effector calprotectin .

Role in Virulence and Antibiotic Resistance

The ArlRS regulatory system in S. aureus is a promising target for screening inhibitors that may eradicate formed biofilms, retard virulence, and break antimicrobial resistance . Recent work has shown that ArlRS also activates the expression of Spx, a transcriptional regulator involved in the response to oxidative stress and antibiotic resistance . ArlR directly activates the expression of mgrA and identifies a probable ArlR binding site (TTTTCTCAT-N 4-TTTTAATAA) .

ArlS as a Drug Target

Histidine kinases are considered promising drug targets because their autophosphorylation is mediated via the conserved catalytic and ATP-binding (CA) domain that contains a typical substrate-binding pocket, which may be suitable for drug screening . Tilmicosin, a macrolide that is active against Gram-positive bacteria by inhibiting bacterial protein synthesis, has a strong inhibitory effect on ArlS kinase activity .

Cross-Talk with Other Two-Component Systems

Although the interaction between a histidine kinase and its cognate response regulator is frequently specific, cross-talk between TCSs can occur, and recent work suggests that ArlR can also be activated by the histidine kinase GraS . Given that multiple histidine kinases may phosphorylate ArlR, the necessity of ArlS to activate ArlR in response to host-imposed Mn and glucose limitation was evaluated .

Key Research Findings

FindingDescription
ArlS is necessary for ArlR activationArlS is essential for activating ArlR in response to manganese sequestration and glucose limitation .
ArlS and virulence factorsThe ArlRS regulatory system is linked to virulence in S. aureus . Inhibitors targeting ArlS could potentially reduce biofilm formation and virulence .
Tilmicosin inhibits ArlSTilmicosin, an FDA-approved macrolide, inhibits ArlS histidine kinase activity .
ArlS and Nutrient SensingArlS is crucial for enabling S. aureus to detect and react to nutritional stress caused by the host . It responds to manganese and glucose limitations .
Cross-activation of ArlRArlR can be activated by other histidine kinases, such as GraS, indicating a level of cross-talk between different two-component systems .
ArlS Role in Gene ExpressionArlS influences the expression of genes involved in oxidative stress response and antibiotic resistance via the transcriptional regulator Spx .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
arlS; SAUSA300_1307; Signal transduction histidine-protein kinase ArlS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-451
Protein Length
full length protein
Species
Staphylococcus aureus (strain USA300)
Target Names
arlS
Target Protein Sequence
MTKRKLRNNWIIVTTMITFVTIFLFCLIIIFFLKDTLHNSELDDAERSSSDINNLFHSKP VKDISALDLNASLGNFQEIIIYDEHNNKLFETSNDNTVRVEPGYEHRYFDRVIKKRYKGI EYLIIKEPITTQDFKGYSLLIHSLENYDNIVKSLYIIALAFGVIATIITATISYVFSTQI TKPLVSLSNKMIEIRRDGFQNKLQLNTNYEEIDNLANTFNEMMSQIEESFNQQRQFVEDA SHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEMNRIIKLVEELLELTKGDVND ISSEAQTVHINDEIRSRIHSLKQLHPDYQFDTDLTSKNLEIKMKPHQFEQLFLIFIDNAI KYDVKNKKIKVKTRLKNKQKIIEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLG LSIAQKIIQLNGGSIKIKSEINKGTTFKIIF
Uniprot No.

Target Background

Function

ArlS is a component of the two-component ArlS/ArlR regulatory system in Staphylococcus aureus. This system plays a crucial role in regulating adhesion, autolysis, multidrug resistance, and virulence. ArlS functions as a sensor histidine kinase, undergoing autophosphorylation at a histidine residue before transferring the phosphate group to ArlR.

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the ArlRS two-component system in Staphylococcus aureus?

The ArlRS system is one of 16 two-component regulatory systems in S. aureus that enables this versatile pathogen to sense and adapt to diverse environments within the human host. It consists of the sensor histidine kinase ArlS and its cognate response regulator ArlR. Research has shown that this system regulates more than 200 genes, including many virulence factors, primarily through controlling expression of global regulators MgrA and Spx . The ArlRS system affects multiple cellular processes, including autolysis, biofilm formation, capsule synthesis, and virulence . As a key regulatory mechanism, understanding ArlRS is essential for comprehending how S. aureus adapts to environmental changes and establishes infection.

How does ArlS function as a histidine kinase?

As a sensor histidine kinase, ArlS responds to specific environmental signals by autophosphorylating a conserved histidine residue. This phosphoryl group is then transferred to a conserved aspartate residue on its cognate response regulator, ArlR . Biochemical studies have demonstrated that ArlS possesses kinase activity toward ArlR in vitro, although with slower kinetics than other similar histidine kinases . This phosphotransfer activity is essential for S. aureus to overcome nutritional stress conditions, particularly calprotectin-induced manganese limitation . The precise sensing mechanism involves detecting specific environmental cues, such as manganese limitation or glucose availability, which then triggers the phosphorylation cascade leading to altered gene expression.

What specific genes and processes are regulated by the ArlS-ArlR system?

RNA-sequencing studies have identified an extensive ArlRS regulon that includes:

  • Cell wall-anchored adhesins (ebh, sdrD)

  • Polysaccharide and capsule synthesis genes

  • Cell wall remodeling genes (lytN, ddh)

  • The urease operon

  • Genes involved in metal transport (feoA, mntH, sirA)

  • Anaerobic metabolism genes (adhE, pflA, nrdDG)

  • Numerous virulence factors (lukSF, lukAB, nuc, gehB, norB, chs, scn, and esxA)

Notably, approximately 70% of the ArlRS regulon overlaps with that of the global regulator MgrA . This significant overlap suggests that ArlRS exerts much of its regulatory influence through a hierarchical network where ArlRS activates MgrA expression, which then regulates downstream targets. This regulatory architecture allows S. aureus to coordinate complex adaptive responses to environmental challenges through a relatively simple signaling system.

How should I design experiments to study ArlS phosphotransfer activity?

When designing experiments to study ArlS phosphotransfer activity, consider the following methodological approach:

  • Protein Purification:

    • Express recombinant ArlS (typically the cytoplasmic domain) and ArlR proteins with appropriate tags for purification

    • Ensure proteins are purified under conditions that maintain their native conformations

    • Verify protein purity using SDS-PAGE and initial activity using preliminary kinase assays

  • In vitro Phosphotransfer Assays:

    • Use radiolabeled ATP (typically [γ-32P]ATP) to monitor phosphorylation

    • Include time-course measurements to capture phosphotransfer kinetics

    • Compare phosphotransfer rates with other histidine kinases as controls

    • Extend incubation times appropriately, as ArlS has been shown to have slower kinetics than other similar histidine kinases

  • Data Collection and Analysis:

ArlS VariantAutophosphorylation Rate (min⁻¹)Phosphotransfer Rate to ArlR (min⁻¹)Relative Activity (%)
Wild-type[value][value]100
H242A[value][value][calculated]
Other variants[value][value][calculated]
  • Controls and Validation:

    • Include no-ATP controls to assess background

    • Test phosphatase activity by pre-phosphorylating ArlR and measuring dephosphorylation

    • Include heat-inactivated proteins as negative controls

    • Validate phosphorylation sites using mass spectrometry

These methodological approaches will enable accurate characterization of ArlS phosphotransfer activity, providing insights into its regulatory mechanism and potential for cross-talk with other two-component systems.

What approaches can I use to study ArlS response to nutritional stress?

To study ArlS response to nutritional stress, particularly manganese limitation and glucose limitation, consider these methodological approaches:

  • Calprotectin-Induced Manganese Limitation Studies:

    • Culture S. aureus in media supplemented with purified calprotectin (CP) at physiologically relevant concentrations

    • Use CP-deficient mutant mice for in vivo studies to compare with wild-type models

    • Monitor ArlS-dependent gene expression changes using reporter constructs or qRT-PCR

    • Create and compare strain variants including wild-type, ΔarlS, ΔarlR, and complemented strains

    • Research has demonstrated that ArlS is necessary for activation of ArlR in response to CP

  • Glucose Limitation Experimental Design:

    • Culture bacteria in defined media with varying glucose concentrations

    • Monitor growth rates and viability under different glucose conditions

    • Measure ArlS activation using phosphorylation-specific detection methods

    • Compare responses between wild-type and arlS mutant strains

  • Experimental Design Example:

StrainGrowth ConditionGene Expression (Fold Change)Mn²⁺ Levels (μM)Survival Rate (%)
S. aureus WTStandard media1.0 (baseline)[measured]100
S. aureus WT+ CP (250 μg/ml)[measured][measured][measured]
S. aureus ΔarlSStandard media[measured][measured][measured]
S. aureus ΔarlS+ CP (250 μg/ml)[measured][measured][measured]
Complemented ΔarlS+ CP (250 μg/ml)[measured][measured][measured]
  • Controls and Validations:

    • Include multiple time points to capture temporal dynamics

    • Verify metal ion levels using ICP-MS or similar techniques

    • Include other nutrient limitations as controls (e.g., iron, zinc)

    • Use both transcriptional and phenotypic readouts to assess responses

These approaches enable comprehensive analysis of how ArlS responds to different nutritional stresses, providing insights into its role in bacterial adaptation during infection.

How does cross-talk between ArlS and other histidine kinases affect experimental outcomes?

Cross-talk between two-component systems can significantly impact experimental outcomes when studying ArlS. Recent research has revealed that ArlR can be cross-activated by another histidine kinase, GraS , creating challenges for interpreting results. To address this complexity, consider the following methodological approaches:

  • Experimental Design to Detect Cross-Talk:

    • Generate single and double knockout mutants (ΔarlS, ΔgraS, ΔarlS/ΔgraS)

    • Measure ArlR phosphorylation or activity in each mutant background

    • Use reporter constructs driven by ArlR-dependent promoters

    • Develop phosphotransfer specificity assays with multiple kinases and response regulators

  • Data Analysis Framework:

Strain BackgroundConditionArlR Activity LevelPrimary ActivatorSecondary Effects
Wild-typeStandard[measured][determined][observed]
Wild-type+CPIncreasedArlS [observed]
ΔarlSStandardLow level remains GraS [observed]
ΔarlS+CPReduced activation [determined][observed]
ΔgraSStandard[measured][determined][observed]
ΔarlS/ΔgraSStandard[measured][determined][observed]
  • Control Approaches:

    • Use ArlR phosphorylation-deficient mutants (e.g., D52A) to confirm specificity

    • Conduct experiments under conditions that selectively activate specific kinases

    • Perform time-course experiments to distinguish primary from secondary phosphorylation events

Research has demonstrated that while cross-talk from GraS to ArlR exists, ArlS is specifically necessary for the activation of ArlR in response to calprotectin and glucose limitation . Understanding this cross-talk is essential for accurately interpreting results and designing robust experiments to study ArlS function.

What methodologies are most effective for studying ArlS-dependent gene regulation?

To effectively study ArlS-dependent gene regulation, researchers should employ multiple complementary approaches:

  • Transcriptomic Analysis:

    • RNA-sequencing to compare wild-type and arlS mutant strains under various conditions

    • Include multiple growth conditions (standard, nutrient limitation, host-relevant)

    • Use time-course experiments to capture dynamic responses

    • RNA-seq has identified that ArlRS regulates more than 200 genes, with 70% overlap with the MgrA regulon

  • Promoter Analysis and DNA Binding Studies:

    • Electrophoretic mobility shift assays (EMSAs) with phosphorylated ArlR

    • DNase I footprinting to identify precise binding sites

    • Studies have identified a probable ArlR binding site sequence of TTTTCTCAT-N4-TTTTAATAA

    • Implement reporter gene assays (e.g., lacZ, lux) driven by ArlR-regulated promoters

  • Hierarchical Regulation Analysis:

    • Create single and double mutants (ΔarlS, ΔmgrA, ΔarlS/ΔmgrA)

    • Measure expression of target genes in each genetic background

    • Construct regulatory network models based on results

    • ArlRS has been shown to directly activate expression of mgrA, creating a hierarchical regulation system

  • Gene Expression Analysis Data Example:

GeneFunctionExpression in WTExpression in ΔarlSExpression in ΔmgrARegulation Type
mgrAGlobal regulatorBaselineDecreased N/ADirect ArlR target
ebhCell wall adhesinBaseline[measured][measured][determined]
sdrDCell wall adhesinBaseline[measured][measured][determined]
lytNCell wall remodelingBaseline[measured][measured][determined]
feoAMetal transportBaseline[measured][measured][determined]

These methodologies, when used in combination, provide a comprehensive understanding of ArlS-dependent gene regulation, including direct and indirect regulatory effects, binding site specificity, and hierarchical regulation through other global regulators like MgrA.

How should I analyze transcriptomic data to identify ArlS-regulated genes?

Analyzing transcriptomic data to identify ArlS-regulated genes requires rigorous statistical approaches and validation strategies:

  • Experimental Design Considerations:

    • Include biological replicates (minimum 3) for statistical power

    • Compare multiple conditions: wild-type vs. ΔarlS, with/without stimuli

    • Include time-course data where appropriate

    • Consider additional mutants (ΔarlR, ΔmgrA) to distinguish direct and indirect effects

  • Primary Data Analysis Pipeline:

    • Quality control of raw reads (FastQC, Trimmomatic)

    • Alignment to reference genome (STAR, Bowtie2)

    • Count generation (HTSeq, featureCounts)

    • Normalization (DESeq2, edgeR)

    • Differential expression analysis with appropriate thresholds (typically fold-change ≥2, adjusted p-value <0.05)

  • Secondary Analysis Approaches:

    • Gene Ontology enrichment analysis

    • KEGG pathway mapping

    • Regulatory motif discovery in promoters of differentially expressed genes

    • Network analysis to identify regulatory modules

    • Comparison with known regulons (e.g., MgrA regulon )

  • Example Data Table Format:

GeneFunctionLog2 Fold Change (ΔarlS/WT)Adjusted p-valueDirect/Indirect RegulationValidation Method
mgrAGlobal regulator-2.51.2e-15Direct qRT-PCR, ChIP
ebhCell wall adhesin-1.83.4e-10IndirectqRT-PCR
sdrDCell wall adhesin-2.15.6e-12IndirectqRT-PCR
lytNCell wall remodeling-1.52.1e-08[determined]qRT-PCR

Through RNA-sequencing, studies have identified that the ArlRS two-component system regulates more than 200 genes, with 70% overlap with the MgrA regulon . This overlap suggests a hierarchical regulation where ArlRS controls many genes indirectly through MgrA. Careful data analysis as outlined above can help distinguish between directly and indirectly regulated genes.

Why might I observe inconsistent ArlS phosphorylation in my experiments?

Inconsistent ArlS phosphorylation results can stem from multiple sources. Here are methodological approaches to identify and address these issues:

  • Protein Quality Considerations:

    • Verify protein folding and stability using circular dichroism

    • Check for degradation using fresh SDS-PAGE analysis

    • Optimize storage conditions (temperature, buffer composition)

    • Use size exclusion chromatography to confirm monomeric state

    • Consider using fusion tags that enhance solubility (MBP, SUMO)

  • Reaction Condition Variables:

    • Standardize buffer composition (pH, ionic strength)

    • Control divalent cation concentrations (Mg²⁺, Mn²⁺)

    • Maintain consistent ATP concentration and quality

    • Control temperature precisely during reactions

    • Ensure consistent protein concentrations across experiments

  • Troubleshooting Data Table:

ObservationPossible CauseDiagnostic TestSolution Strategy
No phosphorylationInactive proteinTest with known active kinaseNew protein preparation
Variable phosphorylation levelsBuffer inconsistencySystematic buffer testingStandardized master mixes
Degradation bandsProtease contaminationAdd protease inhibitorsOptimize purification protocol
Non-specific phosphorylationContaminating kinasesMass spectrometry analysisAdditional purification steps
Decreasing activity over timeProtein instabilityStability time courseOptimize storage conditions
  • Systematic Optimization Approach:

    • Test multiple buffer systems (HEPES, Tris, Phosphate)

    • Vary pH in small increments (pH 6.5-8.0)

    • Test range of salt concentrations (50-300 mM NaCl)

    • Optimize divalent cation concentrations (1-10 mM Mg²⁺)

    • Consider additives (glycerol, reducing agents, stabilizers)

Remember that ArlS has been reported to have slower kinetics than other similar histidine kinases , which may require extended incubation times and more sensitive detection methods. Standardizing all reaction conditions and incorporating appropriate controls in each experiment will help identify the source of inconsistencies.

How can I address challenges in distinguishing direct ArlS-ArlR signaling from cross-talk?

Distinguishing direct ArlS-ArlR signaling from cross-talk with other two-component systems (particularly GraS ) requires specialized experimental approaches:

  • Genetic Approaches:

    • Generate clean deletion mutants (ΔarlS, ΔgraS, double mutants)

    • Create point mutations in phosphorylation sites (ArlS-H, ArlR-D)

    • Use complementation with wild-type or mutated genes

    • Create chimeric proteins to test domain specificity

  • Biochemical Specificity Tests:

    • Purify multiple histidine kinases and response regulators

    • Perform in vitro phosphotransfer assays in all combinations

    • Measure kinetics of phosphotransfer (on-rates, off-rates)

    • Create a phosphotransfer preference matrix

  • In vivo Validation Approaches:

    • Use reporter constructs specifically responsive to ArlR

    • Monitor activation in different genetic backgrounds

    • Apply stimuli known to activate specific systems

    • Compare phenotypic outcomes across mutants

Research has demonstrated that although cross-talk from GraS to ArlR exists, ArlS is specifically necessary for the activation of ArlR in response to calprotectin and glucose limitation . The experimental approaches outlined above can help distinguish direct ArlS-ArlR signaling from cross-talk with other systems in your research.

What are promising research directions for studying ArlS sensing mechanisms?

Several promising research directions exist for investigating ArlS sensing mechanisms:

  • Structural Biology Approaches:

    • Determine the crystal structure of the ArlS sensor domain

    • Implement molecular dynamics simulations to model ligand binding

    • Use hydrogen-deuterium exchange mass spectrometry to identify conformational changes

    • Perform structure-guided mutagenesis to validate sensing mechanisms

  • Metabolite Interaction Studies:

    • ArlS has been proposed to sense changes in glycolytic intermediates

    • Use thermal shift assays to detect metabolite binding

    • Implement isothermal titration calorimetry to quantify binding affinities

    • Develop metabolomics approaches to correlate cellular metabolites with ArlS activation

  • Systems Biology Integration:

    • Create comprehensive models of ArlRS signaling within the broader regulatory network

    • Map connections between nutritional sensing and virulence regulation

    • Investigate how environmental signals are integrated through multiple two-component systems

    • Develop predictive models of ArlS activation under infection-relevant conditions

These approaches offer complementary paths to understanding the molecular mechanisms through which ArlS senses environmental signals and initiates regulatory responses in S. aureus.

How might ArlS research inform therapeutic strategies against S. aureus infections?

Research on ArlS has significant implications for developing novel therapeutic strategies against S. aureus infections:

  • Targeting ArlS-ArlR Signaling:

    • Develop small molecule inhibitors of ArlS kinase activity

    • Design peptide inhibitors that disrupt ArlS-ArlR interactions

    • Target the ArlS sensing domain to prevent activation

    • Create antagonists that block ArlR binding to DNA

  • Experimental Design for Drug Discovery:

    • Establish high-throughput screening assays for ArlS kinase inhibitors

    • Develop cell-based reporter systems to monitor ArlRS pathway inhibition

    • Validate hits through biochemical and structural approaches

    • Test promising compounds in infection models

  • Translational Research Considerations:

    • Since ArlS regulates numerous virulence factors , inhibiting this pathway could reduce S. aureus pathogenicity

    • ArlS is necessary for S. aureus to overcome calprotectin-induced nutritional stress , making it a promising target for infection-specific therapies

    • ArlRS-targeting strategies could potentiate host nutritional immunity mechanisms

By understanding ArlS function at the molecular level, researchers can identify points of intervention that could disrupt S. aureus adaptation and virulence during infection, potentially leading to novel therapeutic approaches against this important pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.