Recombinant Staphylococcus aureus Uncharacterized membrane protein SA0701 (SA0701)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment of your specific requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize development accordingly.
Synonyms
SA0701; Uncharacterized membrane protein SA0701
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-356
Protein Length
full length protein
Species
Staphylococcus aureus (strain N315)
Target Names
SA0701
Target Protein Sequence
MFEAFIYNISVIVAGIYLFHRLQYSENKRMVFSKAYVTVLMTIVSLLLSVYPIPYREDYL IHLTFVPLLFLGRFTNMVYTLSATVIVAIVEIVVFNNSIMYGVTLIVIAAVTSAIGPFLK QNDVLSLLILNVVTIIILFGVALVSPIYTLSEVIILIPISLIITLASAITFVDIWHFFSL VNRYENEDKYDYLTGLGNVKEFDRHLNEISRKAEKEHQSIALLLIDIDGFKDVNDTYSHK SGDAVLKQMSQLLKNYVPNQFKIFRNGGEEFSVVIHNYSLDQSVKLAENIRSGVEKSSFH LPNKEVIKLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRNKVMFNPIINL
Uniprot No.

Target Background

Database Links

KEGG: sau:SA0701

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Staphylococcus aureus membrane protein SA0701 and why is it significant for research?

SA0701 is an uncharacterized membrane protein from Staphylococcus aureus, a gram-positive pathogen responsible for numerous infections ranging from minor skin conditions to life-threatening systemic diseases. Membrane proteins like SA0701 are particularly interesting as they often play critical roles in bacterial virulence, antibiotic resistance, and host-pathogen interactions. As an uncharacterized protein, SA0701 represents an opportunity to discover novel bacterial mechanisms that may be relevant to S. aureus pathogenicity. Understanding such proteins is essential for developing new antimicrobial strategies against multi-drug resistant S. aureus strains .

What bioinformatic approaches should be used for initial characterization of SA0701?

For uncharacterized proteins like SA0701, a comprehensive bioinformatic workflow should include:

  • Sequence homology searches using BLAST, PSI-BLAST, and HHpred to identify distant relatives

  • Transmembrane topology prediction using TMHMM, TOPCONS, and Phobius

  • Structural prediction using AlphaFold2 or RoseTTAFold

  • Functional domain identification using InterProScan and CDD

  • Phylogenetic analysis to determine evolutionary relationships

  • Genomic context examination (neighboring genes often relate functionally)

  • Comparative analysis across S. aureus strains to evaluate conservation

These approaches should be used in combination, as convergent evidence from multiple methods provides more reliable predictions than any single method alone.

What expression systems are most suitable for recombinant SA0701 production?

Expression SystemAdvantagesLimitationsBest Used For
E. coliHigh yield, economical, rapid growthMay not properly fold complex membrane proteinsInitial screening, structural studies
Yeast (P. pastoris)Eukaryotic folding machinery, good for membrane proteinsLonger production time, glycosylation differs from bacterial patternsFunctional studies requiring proper folding
Cell-free systemsAvoids toxicity issues, direct access to reaction conditionsLower yields, expensiveDifficult-to-express proteins, rapid screening
Insect cellsSuperior folding of complex proteinsHigher cost, specialized expertise requiredHigh-quality structural studies
Mammalian cellsNative-like post-translational modificationsMost expensive, lowest yieldsInteraction studies with host factors

For uncharacterized membrane proteins like SA0701, a progressive approach is recommended: start with E. coli systems for initial characterization, then move to more specialized systems if needed for functional or structural studies .

How should researchers design robust experiments to characterize SA0701 function?

Experimental design for characterizing SA0701 should follow established principles of controlled experimentation:

  • Begin with clear hypotheses based on bioinformatic predictions

  • Employ randomization of experimental units where applicable

  • Include appropriate positive and negative controls

  • Use multiple methodological approaches to confirm findings

  • Ensure adequate statistical power through proper sample sizing

  • Control for confounding variables (expression level, tags, buffer conditions)

  • Include biological replicates (different bacterial cultures) and technical replicates

When studying membrane proteins specifically, additional considerations include detergent selection, membrane mimetic environments, and protein orientation . For example, when testing SA0701's potential role in antibiotic resistance, researchers should test multiple antibiotics at various concentrations against both wild-type and SA0701-deficient strains under standardized conditions.

What purification strategy is optimal for recombinant SA0701?

Purifying membrane proteins requires specialized approaches:

  • Select an appropriate detergent for solubilization (test DDM, LDAO, and digitonin)

  • Use affinity chromatography with a fusion tag (His6 or FLAG)

  • Perform ion exchange chromatography to remove contaminants

  • Apply size exclusion chromatography to ensure homogeneity

  • Validate purity using SDS-PAGE, Western blotting, and mass spectrometry

  • Confirm proper folding via circular dichroism or limited proteolysis

Each step should be optimized for SA0701 specifically, with particular attention to protein stability. Buffer conditions (pH, salt concentration, glycerol content) significantly impact membrane protein stability and should be systematically optimized .

How can researchers assess whether SA0701 forms functional complexes?

To determine if SA0701 forms homo- or heteromeric complexes:

  • Use blue native PAGE to analyze native complexes

  • Apply chemical crosslinking followed by mass spectrometry

  • Perform co-immunoprecipitation with potential partner proteins

  • Utilize fluorescence resonance energy transfer (FRET) for in vivo interactions

  • Apply analytical ultracentrifugation to determine stoichiometry

  • Use surface plasmon resonance to measure binding kinetics

  • Perform bacterial two-hybrid assays adapted for membrane proteins

These methods should be applied in combination, as each has distinct strengths and limitations. Particular attention should be paid to maintaining native-like membrane environments during these assays to preserve physiologically relevant interactions .

What approaches are most effective for determining the membrane topology of SA0701?

Membrane topology determination requires multiple complementary methods:

MethodDescriptionAdvantagesLimitations
Computational predictionAlgorithms like TMHMM, HMMTOPFast, no experimental work needed~70-80% accuracy
PhoA/LacZ fusionReporter enzymes fused at different positionsWorks in vivoLabor intensive, may disrupt folding
Substituted cysteine accessibilityCysteine mutations with membrane-permeable and impermeable reagentsHigh resolutionRequires cysteine-less background
Protease protection assaysLimited proteolysis of membrane vesiclesStraightforward interpretationLow resolution
Cryo-EMDirect visualization of protein structureHighest resolutionTechnically challenging, expensive

The gold standard approach combines computational prediction with at least two experimental validation methods. Contradictions between methods should prompt further investigation rather than being discarded .

How can researchers study SA0701's potential role in biofilm formation?

S. aureus biofilm formation is a complex process involving multiple factors. To investigate SA0701's potential role:

  • Generate knockout and complemented strains following established protocols

  • Compare biofilm formation in static and flow cell models

  • Analyze biofilm architecture using confocal microscopy

  • Quantify biomass, thickness, and matrix composition

  • Assess gene expression changes in the mutant during biofilm development

  • Evaluate antibiotic susceptibility in biofilm vs. planktonic conditions

  • Test for interactions with known biofilm-associated proteins (e.g., SarA)

This approach has successfully identified roles for other S. aureus membrane proteins in biofilm formation and could be applied to SA0701 . Since mutation of the sarA locus in S. aureus UAMS-1 impairs biofilm formation both in vitro and in vivo, potential interactions between SA0701 and the SarA regulatory network should be investigated.

What methodologies are appropriate for structural studies of SA0701?

Structural characterization of membrane proteins presents unique challenges:

  • Protein production: Optimize expression to yield milligram quantities of stable protein

  • Crystallization: Screen detergents, lipidic cubic phase, and crystallization conditions

  • Cryo-EM: Consider reconstitution in nanodiscs or amphipols for single-particle analysis

  • NMR spectroscopy: Useful for dynamics studies of specifically labeled domains

  • Hydrogen-deuterium exchange: Maps solvent-accessible regions and conformational changes

  • Small-angle X-ray scattering: Provides low-resolution envelope in solution

  • Molecular dynamics simulations: Predicts behavior in membrane environments

Each method provides complementary information, and researchers should select approaches based on their specific questions about SA0701 structure and function . For initial characterization, cryo-EM may be most appropriate as it requires less protein and accommodates conformational heterogeneity.

How should researchers investigate SA0701's potential role in antibiotic resistance?

Given the importance of antibiotic resistance in S. aureus, a systematic approach includes:

  • Determine minimum inhibitory concentrations (MICs) for multiple antibiotic classes in wild-type vs. SA0701 mutant strains

  • Perform time-kill assays to assess killing kinetics

  • Evaluate membrane permeability using fluorescent dyes

  • Measure antibiotic uptake and efflux rates

  • Assess expression changes in known resistance genes when SA0701 is absent

  • Test for specific binding between SA0701 and antibiotics

  • Examine structural changes in SA0701 upon antibiotic exposure

This approach has successfully characterized the role of other membrane proteins in resistance. For example, studies with daptomycin-resistant S. aureus strains demonstrated that membrane proteins can contribute to resistance through altered membrane composition and fluidity .

What methods can distinguish between different conformational states of SA0701?

Membrane proteins often function through conformational changes. To capture these states:

  • Limited proteolysis: Differential digestion patterns reveal conformational changes

  • Hydrogen-deuterium exchange mass spectrometry: Maps changes in solvent accessibility

  • Site-directed spin labeling with EPR: Measures distances between labeled residues

  • Single-molecule FRET: Captures real-time conformational dynamics

  • Disulfide crosslinking: Traps specific conformations through engineered cysteines

  • Molecular dynamics simulations: Predicts conformational energy landscapes

  • Nanobody selection: Identifies conformation-specific binders

These methods should be applied under conditions that potentially trigger conformational changes, such as ligand binding, pH shifts, or membrane potential changes. This multimodal approach provides the most comprehensive view of SA0701's dynamic behavior.

How can researchers address contradictory results in SA0701 functional studies?

When facing contradictory results:

  • Carefully examine methodological differences between studies

  • Verify protein integrity and proper folding in each experimental system

  • Consider strain-specific effects by testing in multiple S. aureus backgrounds

  • Evaluate environmental conditions (pH, temperature, ionic strength)

  • Assess potential moonlighting functions in different cellular contexts

  • Check for post-translational modifications that might affect function

  • Design decisive experiments specifically targeting the contradiction

This systematic approach helps resolve apparent contradictions. For example, different results in biofilm studies might be reconciled by recognizing strain-specific regulatory networks, as seen with the variable importance of the ica locus in different S. aureus isolates .

What is the potential role of SA0701 in Staphylococcus aureus pathogenicity?

To investigate SA0701's role in virulence:

  • Compare expression levels between clinical isolates with varying virulence

  • Measure expression changes during infection processes

  • Test SA0701 knockout strains in appropriate infection models

  • Evaluate contributions to specific virulence phenotypes (toxin production, immune evasion)

  • Assess interactions with host factors using pull-down assays

  • Determine surface accessibility using antibody binding to intact bacteria

  • Analyze conservation across hypervirulent lineages

This approach aligns with successful characterization of other S. aureus virulence factors. Given that novel bacterial metabolites like merochlorin A show activity against multi-drug resistant S. aureus , understanding membrane proteins like SA0701 could reveal new vulnerability targets.

How should researchers evaluate SA0701 as a potential vaccine target?

Assessment of SA0701 as a vaccine candidate requires:

Evaluation CriterionExperimental ApproachKey Considerations
Surface accessibilityFlow cytometry, protease shavingMust be accessible to antibodies
ConservationSequence analysis across strainsBroadly conserved epitopes preferred
ImmunogenicityAnimal immunization studiesShould elicit strong antibody response
Protective efficacyChallenge studiesMust confer protection against infection
SafetyToxicity studies, homology to human proteinsNo autoimmunity or adverse effects
Formulation stabilityBiochemical and biophysical characterizationStable under storage conditions
Adjuvant compatibilityFormulation studiesEnhances immune response appropriately

This systematic evaluation framework has been applied to other S. aureus vaccine candidates and would be appropriate for SA0701 if initial characterization suggests potential as a vaccine target .

What considerations are important when developing inhibitors targeting SA0701?

For antimicrobial development targeting SA0701:

  • Validate essentiality or virulence contribution through genetic approaches

  • Develop binding or functional assays suitable for high-throughput screening

  • Perform fragment-based screening to identify chemical starting points

  • Apply structure-based design if structural data is available

  • Evaluate hit compounds for spectrum of activity, cytotoxicity, and resistance potential

  • Test for synergy with existing antibiotics

  • Assess pharmacokinetic and pharmacodynamic properties of promising compounds

This pipeline aligns with current approaches in antibiotic discovery. Given that novel compounds like merochlorin A have shown activity against multi-drug resistant S. aureus , systematic screening against membrane proteins like SA0701 could identify new therapeutic candidates.

What strategies can overcome poor expression or instability of recombinant SA0701?

Common challenges with membrane protein expression include:

  • Low expression: Test different promoters, optimize codon usage, lower induction temperature

  • Toxicity: Use tight expression control, evaluate leaderless constructs

  • Inclusion body formation: Try fusion partners (MBP, SUMO), co-express chaperones

  • Degradation: Add protease inhibitors, use protease-deficient host strains

  • Extraction difficulties: Screen multiple detergents (DDM, LDAO, digitonin, SMA)

  • Aggregation: Optimize buffer conditions, add stabilizing agents (glycerol, specific lipids)

  • Construct optimization: Test truncations to remove flexible regions while maintaining function

These approaches should be systematically evaluated to identify conditions yielding functional SA0701 . The optimal strategy likely combines multiple interventions tailored to the specific properties of SA0701.

How can researchers validate antibodies for specific detection of SA0701?

Antibody validation should include:

  • Testing against recombinant SA0701 as positive control

  • Verification using SA0701 knockout strains as negative control

  • Peptide competition assays to confirm epitope specificity

  • Evaluation across multiple applications (Western blot, immunofluorescence)

  • Cross-reactivity testing against related proteins

  • Batch-to-batch consistency verification

  • Validation in the intended experimental context

This rigorous validation process ensures reliable detection of SA0701 and prevents misleading results from non-specific antibody binding, which is particularly important for uncharacterized proteins where limited prior knowledge exists.

What are the best practices for reproducibility in SA0701 research?

To ensure reproducible research:

  • Document detailed methods including strain information, growth conditions, and buffer compositions

  • Validate all reagents, particularly antibodies and expression constructs

  • Include all appropriate controls in each experiment

  • Perform biological replicates (different bacterial cultures) and technical replicates

  • Use quantitative methods with appropriate statistical analysis

  • Share materials and detailed protocols with the research community

  • Report negative and contradictory results alongside positive findings

These practices align with experimental design principles and are essential for building a reliable knowledge base about uncharacterized proteins like SA0701, where initial characterization will guide subsequent research directions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.