Recombinant Staphylococcus aureus Uncharacterized sensor-like histidine kinase MW0199 (MW0199)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
hptS; MW0199; Sensor protein kinase HptS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-518
Protein Length
full length protein
Species
Staphylococcus aureus (strain MW2)
Target Names
MW0199
Target Protein Sequence
MTAYKPYRHQLRRSLFASTIFPVFLVIIIGLVSFYAIYIWIEHRTIHQHVDESQSSLHHT EKQIQTFITQHNNSFQELDLTNHHDVTATKRGLLKLIHQQPATLYYELSGPNQFITNNYE HLNTKNMYLFSTHQLKFKNSTYMLKIYMANTPRLSEIKKDSRQFALIVDQYDNILYANDD RFTIGEKYRPQQFGFMNESVKLNHADHRLIIYKDIHENIEDGITLLIVMAVVLVLLVIFG FISADNMAKRQTKDIETIIQKIYYAKNRHLGTYTPLKNNSELEEINNYIYDLFESNEQLI HSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQYLITLSPKLAQTVVQQLSQMLRYSL RTNSHTVELNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMMLQPLIENAIK HGRDTESLDITIRLTLARQNLHVLVCDNGIGMSSSRLQYVRQSLNNDVFDTKHLGLNHLH NKAMIQYGSHARLHIFSKRNQGTLICYKIPLSRGNVDV
Uniprot No.

Target Background

Function
MW0199 is a member of the two-component regulatory system HptS/HptR in *Staphylococcus aureus*. This system regulates genes involved in hexose phosphate transport in response to extracellular phosphate levels. MW0199 likely functions as a sensor protein kinase, autophosphorylating at a histidine residue and subsequently transferring the phosphate group to a conserved aspartic acid residue in the HptS regulatory domain. HptS, in turn, antagonizes CcpA-dependent transcription of genes associated with antibiotic susceptibility.
Database Links

KEGG: sam:MW0199

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MW0199 and how is it classified within S. aureus proteins?

MW0199 (also known as hptS or Sensor protein kinase HptS) is an uncharacterized sensor-like histidine kinase from Staphylococcus aureus. It belongs to the two-component signal transduction system family, which typically consists of a sensor histidine kinase and a response regulator. The full-length protein consists of 518 amino acids (UniProt ID: Q8NYJ8) and functions as a transmembrane signaling protein that likely couples extracytosolic sensing to cytosolic effector responses . Like other histidine kinases, MW0199 presumably acts as an environmental sensor that transmits signals through phosphorylation cascades, allowing bacterial adaptation to changing conditions.

What are the recommended methods for recombinant expression of MW0199?

For recombinant expression of MW0199, E. coli is the recommended heterologous expression system. The most effective approach involves:

  • Gene synthesis or PCR amplification of the MW0199 coding sequence from S. aureus genomic DNA

  • Cloning into an expression vector with an N-terminal His-tag for purification

  • Transformation into an appropriate E. coli strain (typically BL21(DE3) or similar)

  • Culture in rich media (LB or TB) until mid-log phase (OD600 ≈ 0.6-0.8)

  • Induction with IPTG (typically 0.5-1.0 mM) at reduced temperature (16-18°C) overnight to minimize inclusion body formation

  • Cell harvest and lysis in buffer containing appropriate protease inhibitors

  • Purification via nickel affinity chromatography followed by size exclusion chromatography

This approach mirrors successful strategies used for other membrane-associated histidine kinases and maximizes yield of properly folded protein. For transmembrane proteins like MW0199, addition of mild detergents (such as n-dodecyl-β-D-maltoside) during extraction and purification is essential for solubilization while preserving structural integrity.

What are the optimal storage conditions for maintaining MW0199 stability and activity?

To maintain MW0199 stability and activity, the following storage conditions are recommended:

  • Store the purified protein at -20°C/-80°C as aliquots to avoid repeated freeze-thaw cycles

  • Use a storage buffer containing Tris/PBS with 6% trehalose at pH 8.0

  • For long-term storage, add glycerol to a final concentration of 20-50%

  • When reconstituting lyophilized protein, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Working aliquots may be stored at 4°C for up to one week

These conditions help maintain the protein's structural integrity and enzymatic activity by preventing aggregation and protecting against denaturation during freeze-thaw cycles.

How does MW0199 participate in two-component signal transduction?

While the specific signaling pathway of MW0199 remains largely uncharacterized, it likely follows the canonical mechanism of bacterial two-component systems:

  • Signal detection: The N-terminal sensor domain of MW0199 detects specific environmental stimuli (potentially similar to how ArlS in S. aureus responds to manganese levels or glucose availability)

  • Autophosphorylation: Upon signal detection, conformational changes trigger ATP-dependent autophosphorylation of a conserved histidine residue in the DHp domain

  • Phosphotransfer: The phosphoryl group is transferred from the histidine residue of MW0199 to an aspartate residue on its cognate response regulator (currently unidentified)

  • Transcriptional modulation: The phosphorylated response regulator binds to specific DNA sequences to regulate gene expression

The allosteric coupling between sensor and catalytic domains involves intramolecular conformational changes, as demonstrated in other histidine kinases like PhoQ, where signal sensing in the periplasm is transmitted through the transmembrane and HAMP domains to modulate kinase activity .

What environmental stimuli might MW0199 respond to based on homology with other S. aureus histidine kinases?

Based on homology with other characterized S. aureus histidine kinases and analyses of two-component systems in related bacteria:

  • Metal ion sensing: Similar to ArlS, which responds to manganese levels, MW0199 may sense specific metal ions. The presence of potential metal-binding residues in its sensing domain suggests a role in monitoring metal availability in the host environment

  • Nutrient availability: The sensor domain might detect changes in carbon source availability, similar to how ArlS responds to glucose limitation

  • Osmotic stress: By analogy to histidine kinases in cyanobacteria (Hik16, Hik33, Hik34, and Hik41), MW0199 could participate in osmotic or salt stress responses

  • Host defense molecules: The membrane-spanning domain might detect antimicrobial peptides or other host immune effectors

  • pH changes: The extracellular domain could function as a pH sensor, helping S. aureus adapt to acidic environments encountered during infection

Experimental confirmation of these potential stimuli would require systematic testing using purified protein and/or genetic approaches with S. aureus mutants lacking functional MW0199.

What phosphorylation assays can be used to assess MW0199 kinase activity in vitro?

Several complementary approaches can be used to assess MW0199 kinase activity:

  • Radioactive ATP assay:

    • Incubate purified MW0199 with [γ-32P]ATP

    • Terminate reactions at various time points

    • Separate proteins by SDS-PAGE

    • Detect autophosphorylation by autoradiography

    • Quantify incorporation of 32P into MW0199

  • Phospho-specific antibodies:

    • Generate antibodies that specifically recognize phosphorylated histidine residues

    • Perform Western blotting after in vitro kinase reactions with ATP

    • Quantify signals to measure relative phosphorylation levels

  • Phos-tag acrylamide gel electrophoresis:

    • Perform kinase reactions with unlabeled ATP

    • Separate phosphorylated from non-phosphorylated forms using Phos-tag™ acrylamide gels

    • Visualize with Coomassie staining or Western blotting

  • Coupled enzyme assays:

    • Monitor ADP production (a byproduct of kinase activity) using coupled enzyme reactions

    • Measure absorbance changes as ADP is converted to ATP and then to other products

These assays should be conducted under varying conditions (pH, temperature, ion concentrations) to identify optimal activity parameters for MW0199 and potential regulatory factors.

How can knockout or knockdown approaches be used to study MW0199 function in S. aureus?

To study MW0199 function through genetic approaches:

  • Gene knockout using homologous recombination:

    • Create a knockout construct containing antibiotic resistance gene flanked by sequences homologous to regions adjacent to MW0199

    • Transform S. aureus with this construct

    • Select for double crossover events using appropriate antibiotics

    • Confirm deletion by PCR and sequencing

  • CRISPR-Cas9 editing:

    • Design guide RNAs targeting MW0199

    • Clone into a CRISPR-Cas9 vector optimized for S. aureus

    • Transform bacteria and select for editing events

    • Screen for successful knockouts by sequencing

  • Antisense RNA approaches:

    • Construct plasmids expressing antisense RNA complementary to MW0199 mRNA

    • Place under control of an inducible promoter

    • Transform into S. aureus

    • Induce expression to reduce MW0199 protein levels

    • Confirm knockdown by Western blotting

  • Phenotypic characterization of mutants:

    • Assess growth under various stress conditions

    • Measure virulence factor production

    • Test antibiotic susceptibility

    • Evaluate biofilm formation

    • Compare transcriptomes with wild-type using RNA-seq

Similar approaches were used to identify the role of histidine kinases in cyanobacteria, where a library of strains with mutations in all 43 histidine kinases was screened by DNA microarray analysis to identify those involved in salt stress responses .

How does MW0199 structurally compare to other characterized histidine kinases in S. aureus?

MW0199 shares several structural features with other characterized S. aureus histidine kinases:

FeatureMW0199ArlSWalKGraS
Amino acid length518 aa~450 aa~610 aa~350 aa
Transmembrane domainsMultiple predicted222
HAMP domainPresentPresentPresentPresent
DHp domainPresentPresentPresentPresent
CA domainPresentPresentPresentPresent
Cognate response regulatorUnknownArlRWalRGraR
Known stimuliUncharacterizedManganese, glucoseCell wall stressAMPs

Notable distinctions include MW0199's apparently more complex transmembrane region, suggesting potentially unique sensing capabilities. While ArlS is necessary for activation of its response regulator ArlR during manganese sequestration and glucose limitation , the specific environmental cues sensed by MW0199 and its downstream targets remain to be characterized.

What insights from other histidine kinase mechanisms can be applied to MW0199 research?

Research on other histidine kinases provides valuable frameworks for investigating MW0199:

  • Domain-swapping experiments: Based on approaches used with PhoQ, creating chimeric proteins by swapping domains between MW0199 and well-characterized histidine kinases could help identify functional regions. Inserting helix-disrupting glycine residues at domain interfaces can help determine how sensor and catalytic domains communicate

  • Signal transduction models: The allosteric coupling model developed for PhoQ, where binding of ligands modulates equilibrium between active and inactive states, could be applied to understand MW0199 activation mechanisms

  • Cross-talk analysis: Studies of ArlS and GraS in S. aureus revealed that some response regulators can be activated by non-cognate kinases under specific conditions. Investigating whether MW0199 exhibits similar cross-talk would be valuable

  • Structural biology approaches: X-ray crystallography and cryo-EM techniques used to resolve structures of other histidine kinases could be applied to MW0199 to understand its activation mechanism

  • Microarray screening approaches: The comprehensive screening methodology used to identify roles of cyanobacterial histidine kinases in salt stress could be adapted to determine MW0199's function in S. aureus

How might MW0199 contribute to S. aureus pathogenesis and virulence?

While direct evidence for MW0199's role in pathogenesis is lacking, several hypotheses can be formulated based on knowledge of other histidine kinases in S. aureus:

  • Adaptation to host environments: MW0199 may sense host-derived signals to regulate genes needed for survival in specific host niches, similar to how ArlS responds to manganese limitation imposed by host immune proteins like calprotectin

  • Virulence factor regulation: Two-component systems in S. aureus often regulate virulence factor expression. MW0199 could modulate toxin production, adhesin expression, or immune evasion factors in response to host cues

  • Stress response coordination: MW0199 might help S. aureus survive antimicrobial pressures encountered during infection, similar to how histidine kinases in cyanobacteria coordinate responses to environmental stresses

  • Metabolic adaptation: By analogy to ArlS, which responds to glucose limitation, MW0199 could help S. aureus adapt its metabolism to nutrient-limited conditions within the host

  • Biofilm formation: Many two-component systems influence biofilm development, a critical virulence trait in S. aureus infections

Testing these hypotheses would require generating MW0199 knockout strains and assessing their virulence in various infection models.

Could MW0199 be a potential target for novel anti-staphylococcal therapeutics?

MW0199 has several characteristics that make it a potentially attractive therapeutic target:

  • Conservation and essentiality: If MW0199 proves to be conserved across S. aureus strains and important for virulence or survival, it could represent a broadly applicable target

  • Uniqueness to prokaryotes: Histidine kinases are absent in humans, potentially allowing for selective targeting without host toxicity

  • Druggable catalytic domain: The ATP-binding pocket of histidine kinases presents an opportunity for small molecule inhibitor development

  • Potential for attenuating virulence: Targeting MW0199 could potentially reduce pathogenicity without imposing strong selective pressure for resistance, unlike conventional antibiotics

To validate MW0199 as a therapeutic target, researchers would need to:

  • Confirm its importance in infection models

  • Develop high-throughput screening assays for inhibitor discovery

  • Solve its crystal structure to enable structure-based drug design

  • Assess potential for resistance development

  • Evaluate efficacy of inhibitors in animal models

What proteomic approaches can identify MW0199's cognate response regulator and downstream targets?

Several complementary proteomic approaches can help identify MW0199's signaling partners:

  • Bacterial two-hybrid screening:

    • Create fusion constructs of MW0199 DHp domain with a DNA-binding domain

    • Screen against a library of S. aureus response regulators fused to an activation domain

    • Positive interactions activate reporter gene expression

    • Validate hits with complementary methods

  • Co-immunoprecipitation coupled with mass spectrometry:

    • Express tagged MW0199 in S. aureus

    • Crosslink protein complexes

    • Immunoprecipitate MW0199

    • Identify co-precipitating proteins by mass spectrometry

  • Phosphotransfer profiling:

    • Purify MW0199 and all S. aureus response regulators

    • Perform in vitro phosphotransfer assays

    • Monitor phosphorylation of response regulators over time

    • Identify preferential phosphotransfer partners

  • ChIP-seq of response regulators:

    • Compare wild-type and MW0199 knockout strains

    • Perform ChIP-seq with antibodies against candidate response regulators

    • Identify differential binding events dependent on MW0199

  • Comparative phosphoproteomics:

    • Compare phosphorylation profiles between wild-type and MW0199 mutants

    • Identify differentially phosphorylated response regulators

    • Map phosphorylation-dependent regulatory networks

These approaches could reveal not only the cognate response regulator of MW0199 but also identify potential cross-talk with other two-component systems.

How can structural biology techniques elucidate MW0199's activation mechanism?

Advanced structural biology approaches to investigate MW0199's activation mechanism include:

  • X-ray crystallography:

    • Crystallize the sensor domain, DHp/CA domains, and full-length protein when possible

    • Solve structures in both apo and ligand-bound states

    • Compare conformational differences to understand activation-associated changes

  • Cryo-electron microscopy (Cryo-EM):

    • Particularly valuable for full-length MW0199 with its transmembrane regions

    • Can capture different conformational states in a more native-like environment

    • Enables visualization of large complexes with response regulators

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Probe conformational dynamics and solvent accessibility

    • Compare exchange patterns in active versus inactive states

    • Identify regions involved in conformational changes during activation

  • Site-directed spin labeling with electron paramagnetic resonance (SDSL-EPR):

    • Introduce spin labels at strategic positions

    • Measure distances between labeled sites

    • Track conformational changes upon activation

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Suitable for individual domains

    • Provides information on protein dynamics

    • Can detect ligand binding and conformational changes

These approaches, similar to those applied to understand allosteric mechanisms in PhoQ , would provide insights into how signal perception is transmitted across domains to modulate kinase activity in MW0199.

What are the most pressing questions about MW0199 that need to be addressed?

The most critical unresolved questions regarding MW0199 include:

  • What environmental signals or ligands does MW0199 sense, and what is the molecular mechanism of signal detection?

  • Which response regulator(s) serves as MW0199's phosphorylation target, and what genes does this regulator control?

  • What role does MW0199 play in S. aureus adaptation to host environments and virulence?

  • How does the three-dimensional structure of MW0199 change during activation, and what are the key residues involved in signal transduction?

  • Is MW0199 essential for S. aureus survival under specific conditions, and could it serve as a viable therapeutic target?

Addressing these questions will require integrated approaches combining biochemistry, structural biology, genetics, and infection models.

How can researchers overcome challenges in studying membrane-associated histidine kinases like MW0199?

Working with membrane-associated histidine kinases presents several challenges that can be addressed through specialized approaches:

  • Protein solubilization and purification:

    • Use mild detergents (DDM, LMNG) or amphipols for extraction

    • Consider nanodiscs or styrene-maleic acid lipid particles (SMALPs) to maintain native-like membrane environment

    • Express soluble domains separately for initial characterization

  • Functional reconstitution:

    • Reconstitute purified protein into liposomes with defined lipid composition

    • Establish activity assays that work in lipid environments

    • Consider cell-free expression systems directly into liposomes

  • Structure determination:

    • Use stabilizing mutations or nanobodies to facilitate crystallization

    • Apply cryo-EM for full-length protein in membrane mimetics

    • Adopt integrative structural biology approaches combining multiple techniques

  • Signal identification:

    • Perform unbiased ligand screening using differential scanning fluorimetry

    • Utilize transcriptomic approaches to identify conditions that activate the system

    • Apply metabolomics to identify potential small molecule signals

  • Genetic manipulation:

    • Use inducible systems to overcome potential essentiality

    • Consider domain-based complementation to identify critical functional regions

    • Employ CRISPR interference for tunable repression rather than complete knockout

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.