Recombinant Staphylococcus aureus Uncharacterized sensor-like histidine kinase SA0216 (SA0216)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your required tag type for preferential development.
Synonyms
hptS; SA0216; Sensor protein kinase HptS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-518
Protein Length
full length protein
Species
Staphylococcus aureus (strain N315)
Target Names
SA0216
Target Protein Sequence
MTAYKPYRHQLRRSLFASTIFPVFLVIIIGLVSFYAIYIWIEHRTIHQHVDESQSSLHHT EKQIQTFITQHNNSFQELDLTNHHDVTATKRELLKLIHQQPATLYYELSGPNQFITNNYE HLNTKNMYLFSTHQLKFNNSTYMLKIYMANTPRLSEIKKDSRQFALIVDQYDNILYANDD RFTIGEKYRPQQFGFMNESVKLNHADHRLIIYKDIHENIEDGITLLIVMAVVLVLLVIFG FISADNMAKRQTKDIETIIQKIYYAKNRHLGTYTPLKNNSELEEINNYIYDLFESNEQLI HSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQYLITLSPKLAQTVVQQLSQMLRYSL RTNSHTVELNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMMLQPLIENAIK HGRDTESLDITIRLTLARQNLHVLVCDNGIGMSSSRLQYVRQSLNNDVFDTKHLGLNHLH NKAMIQYGSHARLHIFSKRNQGTLICYKIPLSRGNVDV
Uniprot No.

Target Background

Function
SA0216 is a member of the two-component regulatory system HptS/HptR in *Staphylococcus aureus*. This system regulates genes involved in hexose phosphate transport, responding to changes in extracellular phosphate availability. SA0216 likely functions as a sensor protein kinase, autophosphorylating at a histidine residue and subsequently transferring the phosphate group to a conserved aspartic acid residue in the HptS regulatory domain. HptS, in turn, antagonizes CcpA-dependent transcription of genes involved in antibiotic susceptibility.
Database Links

KEGG: sau:SA0216

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of sensor histidine kinases in S. aureus two-component systems?

Sensor histidine kinases in S. aureus function as part of two-component systems (TCSs) that enable the bacterium to sense and respond to environmental stimuli. Structurally, these proteins typically contain:

  • N-terminal sensing domains (often transmembrane)

  • HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, and Phosphatases) domains

  • HisKA (Histidine Kinase A) domains containing the conserved histidine residue for autophosphorylation

  • HATPase_c (Histidine kinase-like ATPases) domains

For example, SaeS, a well-characterized sensor histidine kinase, is a 351-amino-acid polypeptide with two transmembrane segments at the N-terminus. The transmembrane segments are separated by only nine extracellular amino acid residues, which is considered too small to be a signal binding domain. The cytoplasmic portion contains HAMP (amino acids 61-114), HisKA (amino acids 122-189), and HATPase_c (amino acids 234-348) domains, with His131 being the predicted autophosphorylation site .

How do uncharacterized histidine kinases like SA0216 relate to better-studied kinases such as SaeS and ArlS?

Uncharacterized histidine kinases such as SA0216 likely share structural and functional similarities with well-studied kinases like SaeS and ArlS, but may have distinct sensing mechanisms, binding partners, or regulatory roles. Based on characterized histidine kinases:

  • They likely function in two-component signaling pathways where the kinase senses environmental stimuli and phosphorylates a response regulator

  • They may contain similar domain architectures but with variations in sensing domains that determine stimulus specificity

  • They probably undergo autophosphorylation at a conserved histidine residue, followed by phosphotransfer to an aspartate residue on their cognate response regulator

For instance, both SaeS and ArlS are essential for the phosphorylation and activation of their respective response regulators (SaeR and ArlR) . By analogy, SA0216 would be expected to phosphorylate a specific response regulator, although this partner and its regulated genes remain to be identified.

What experimental approaches are recommended for initial characterization of an uncharacterized histidine kinase?

Initial characterization of an uncharacterized histidine kinase like SA0216 should include:

  • Sequence analysis and domain prediction:

    • Identify conserved domains and potential autophosphorylation sites

    • Predict transmembrane regions and potential sensing domains

    • Compare with characterized histidine kinases

  • Gene expression analysis:

    • Determine expression patterns under various conditions

    • Identify potential co-expressed genes that might be regulated by the same system

  • Gene deletion studies:

    • Create isogenic deletion mutants (e.g., USA300ΔSA0216)

    • Compare phenotypes with wild-type under various conditions

    • Assess impact on virulence factor expression

  • Protein purification and biochemical characterization:

    • Express and purify recombinant protein

    • Assess autophosphorylation activity

    • Identify potential phosphorylation targets

This approach mirrors successful characterization studies of other S. aureus histidine kinases like SaeS and ArlS .

How can researchers determine the specific environmental stimuli sensed by an uncharacterized histidine kinase like SA0216?

Determining the environmental stimuli for an uncharacterized histidine kinase requires a systematic approach:

  • Comparative transcriptomics under varied conditions:

    • Subject wild-type and kinase mutant strains to various environmental conditions (pH changes, nutrient limitation, oxidative stress, antimicrobial exposure)

    • Perform RNA-seq to identify differential gene expression patterns

    • Look for conditions where wild-type shows a response but the mutant doesn't

  • Phosphorylation assays with potential stimuli:

    • Use purified recombinant kinase for in vitro autophosphorylation assays

    • Test various potential stimuli for their effect on phosphorylation activity

    • Similar to approaches used with ArlS, which responds to manganese starvation and glucose limitation

  • Reporter fusion systems:

    • Create promoter-reporter fusions for genes potentially regulated by the kinase

    • Monitor reporter activity in response to different environmental conditions

    • For example, the mgrA-P2 reporter was used to assess ArlR activation in response to calprotectin and glucose availability

  • Structural studies of sensing domains:

    • Perform crystallography or NMR studies of the sensing domain

    • Conduct ligand binding assays with potential stimuli

    • Identify conformational changes upon stimulus binding

These approaches have successfully identified that ArlS responds to manganese sequestration by calprotectin and glucose limitation, while SaeS responds to environmental stimuli related to neutrophil interaction .

What methods are most effective for identifying the cognate response regulator of SA0216?

To identify the cognate response regulator of an uncharacterized histidine kinase like SA0216, researchers should consider:

  • Genomic context analysis:

    • Examine adjacent genes, as response regulators are often encoded in the same operon as their cognate kinases

    • Look for conserved genetic arrangements across related bacterial species

  • In vitro phosphotransfer profiling:

    • Express and purify recombinant SA0216 and a library of S. aureus response regulators

    • Perform phosphotransfer assays to identify specific phosphorylation targets

    • Determine phosphotransfer kinetics to differentiate between cognate and cross-talk interactions

  • Bacterial two-hybrid assays:

    • Screen for protein-protein interactions between SA0216 and response regulators

    • Validate interactions with co-immunoprecipitation or pull-down assays

  • Complementation studies with point mutations:

    • Create phosphorylation-deficient variants (e.g., H→A mutation at the predicted autophosphorylation site)

    • Test whether these variants can complement deletion phenotypes

    • Similar to the demonstration that ArlS H242A failed to rescue the induction of the mgrA-P2 promoter in response to calprotectin

  • Comparative phosphoproteomics:

    • Compare phosphorylation patterns between wild-type and kinase mutant strains

    • Identify response regulators with differential phosphorylation

These approaches could reveal whether SA0216 has a dedicated cognate response regulator or if cross-phosphorylation occurs, as seen with GraS potentially phosphorylating ArlR .

How can researchers distinguish between direct and indirect effects when studying histidine kinase regulatory networks?

Distinguishing between direct and indirect effects in histidine kinase regulatory networks requires:

  • ChIP-seq analysis of response regulator binding:

    • Identify genome-wide binding sites of the response regulator

    • Define the direct regulon controlled by the two-component system

    • Compare with transcriptomic changes to identify indirect effects

  • DNase I footprinting assays:

    • Determine precise binding sites of phosphorylated response regulators

    • Identify consensus binding sequences

    • For example, DNase I footprinting revealed that SaeR binds to a direct repeat sequence (GTTAAN₆GTTAA) in its target promoters

  • Promoter mutation studies:

    • Create point mutations in predicted binding sites

    • Assess the impact on both in vitro binding and in vivo promoter function

    • Similar to experiments showing that mutations in the SaeR binding sequence greatly reduced both in vitro binding and in vivo function of the P1 promoter

  • Time-resolved transcriptomics:

    • Perform time-course studies after stimulus application

    • Identify primary (early) and secondary (late) transcriptional responses

    • Distinguish direct targets from downstream effects

  • Epistasis analysis:

    • Create double mutants with the histidine kinase and potential downstream regulators

    • Determine whether phenotypes are additive or if one is epistatic to the other

These approaches help create a hierarchical map of the regulatory network and distinguish primary targets from downstream effects.

What controls should be included when designing experiments to characterize SA0216 phosphorylation activity?

When characterizing SA0216 phosphorylation activity, essential controls include:

  • Negative controls:

    • Phosphorylation-deficient mutant (H→A at predicted autophosphorylation site)

    • Heat-inactivated kinase

    • Reaction without ATP

    • Similar to ArlS H242A variant used as a control for phosphotransfer activity

  • Positive controls:

    • Well-characterized histidine kinase (e.g., SaeS) in parallel experiments

    • Constitutively active kinase variant if available

  • Specificity controls:

    • Non-cognate response regulators to assess specificity

    • Phosphorylation assays with cell lysates from wild-type vs. deletion mutants

    • Similar to experiments showing that cell lysates from SaeS transposon mutants failed to phosphorylate SaeR

  • Environmental condition controls:

    • Test phosphorylation under various buffer conditions (pH, salt concentration)

    • Include relevant physiological stimuli and non-stimuli

    • Time-course measurements to capture kinetics

  • Technical validation:

    • Multiple detection methods (e.g., radioactive [γ-³²P]ATP labeling and Phos-tag SDS-PAGE)

    • Biological and technical replicates

These controls would help validate that any observed phosphorylation activity is specific to SA0216 and physiologically relevant, similar to how SaeS phosphorylation of SaeR was characterized .

How should researchers design experiments to investigate potential cross-talk between SA0216 and other two-component systems?

To investigate potential cross-talk between SA0216 and other two-component systems:

  • In vitro phosphotransfer profiling:

    • Test phosphotransfer from SA0216 to multiple response regulators

    • Test phosphorylation of SA0216's predicted cognate response regulator by other kinases

    • Compare phosphotransfer kinetics to distinguish primary from secondary interactions

  • Genetic approach:

    • Create single and double deletion mutants (e.g., ΔSA0216, ΔSaeS, ΔSA0216/ΔSaeS)

    • Analyze phenotypes and gene expression profiles of single vs. double mutants

    • Look for non-additive effects suggesting functional relationships

  • Reporter fusion studies:

    • Use promoter-reporter fusions for genes regulated by different two-component systems

    • Test reporter activity in various kinase/regulator knockout backgrounds

    • Similar to how mgrA-P2 reporter was used to assess ArlR activation in various strain backgrounds

  • Competitive phosphorylation assays:

    • Set up reactions with multiple kinases and response regulators

    • Analyze preferential phosphorylation patterns

    • Determine hierarchy of phosphotransfer specificity

  • Systems approach:

    • Global phosphoproteomics in single and multiple kinase mutants

    • Network analysis of transcriptomic changes

This approach would help determine if SA0216 exhibits cross-talk similar to what has been suggested between GraS and ArlR, where GraS may cross-activate ArlR in addition to its cognate partner GraR .

What methodological considerations are important when generating recombinant SA0216 for in vitro studies?

When generating recombinant SA0216 for in vitro studies, important methodological considerations include:

  • Construct design:

    • Full-length protein vs. cytoplasmic domain only (transmembrane proteins often have solubility issues)

    • Selection of appropriate tags (His, GST, MBP) for purification

    • Inclusion of flexible linkers between protein and tags

    • Consideration of tag position (N- or C-terminal) to avoid interference with function

  • Expression system selection:

    • E. coli strains optimized for membrane protein expression

    • Cell-free expression systems for potentially toxic proteins

    • Codon optimization for heterologous expression

  • Solubilization and purification:

    • Detergent selection for membrane protein extraction

    • Buffer optimization to maintain stability and activity

    • Inclusion of stabilizing agents (glycerol, reducing agents)

    • Purification under conditions that preserve phosphorylation capacity

  • Quality control:

    • Size exclusion chromatography to assess oligomeric state

    • Circular dichroism to verify proper folding

    • Mass spectrometry to confirm protein integrity

    • Activity assays to verify function post-purification

  • Storage considerations:

    • Optimal buffer conditions for long-term stability

    • Aliquoting to avoid freeze-thaw cycles

    • Activity testing after storage

These considerations would help ensure that recombinant SA0216 retains its native structure and functional properties for meaningful in vitro studies.

How should researchers approach conflicting data when studying histidine kinase function?

When faced with conflicting data in histidine kinase research, a systematic approach includes:

  • Technical validation:

    • Replicate experiments using alternative methods

    • Verify reagent quality and specificity

    • Examine experimental conditions for subtle differences

    • Ensure proper controls were included

  • Biological context consideration:

    • Strain background effects (laboratory vs. clinical isolates)

    • Growth conditions and growth phase differences

    • Media composition variations

    • Similar to how SaeS activity differs between strain Newman (constitutively active due to L18P mutation) and USA300-0114

  • Hierarchical analysis:

    • Distinguish between direct biochemical observations and downstream effects

    • Consider network complexity and potential compensatory mechanisms

    • Evaluate the time scale of observations (immediate vs. long-term responses)

  • Develop testable hypotheses to explain discrepancies:

    • Design experiments specifically to address contradictions

    • Consider context-dependent activity or regulatory mechanisms

    • Similar to investigations showing that while multiple kinases might phosphorylate ArlR, specific responses to calprotectin and glucose limitation require ArlS

  • Mathematical modeling:

    • Develop computational models incorporating all observations

    • Identify parameters that might explain apparently conflicting results

    • Test model predictions experimentally

This approach acknowledges that apparent contradictions may reflect biological complexity rather than experimental error.

What statistical approaches are most appropriate for analyzing phosphorylation assay data?

For analyzing phosphorylation assay data from histidine kinase studies:

  • Quantification methods:

    • Densitometric analysis of autoradiography or Western blot bands

    • Normalization to total protein or internal standards

    • Time-course curve fitting (typically first-order kinetics)

  • Statistical tests for comparing conditions:

    • Paired t-tests for comparing phosphorylation levels under different conditions

    • ANOVA for multiple condition comparisons with appropriate post-hoc tests

    • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) for non-normally distributed data

  • Kinetic parameter estimation:

    • Michaelis-Menten kinetics for enzymatic activity

    • Calculation of phosphorylation and dephosphorylation rate constants

    • Binding affinity determination for stimulus-kinase interactions

  • Replicate considerations:

    • Minimum of three biological replicates

    • Technical replicates within each biological replicate

    • Power analysis to determine appropriate sample size

  • Visualizing uncertainty:

    • Error bars representing standard deviation or standard error

    • Confidence intervals for kinetic parameters

    • Explicit statement of statistical methods in figure legends

These approaches ensure robust analysis of phosphorylation data and facilitate comparison between different experimental conditions or protein variants.

How can phosphoproteomic data be effectively analyzed to identify SA0216 targets?

To effectively analyze phosphoproteomic data for identifying SA0216 targets:

  • Experimental design considerations:

    • Compare wild-type, ΔSA0216, and complemented strains

    • Include phosphorylation-deficient SA0216 variant

    • Sample at multiple time points after stimulus application

    • Enrich for phosphopeptides using techniques like immobilized metal affinity chromatography (IMAC)

  • Data processing workflow:

    • Quality filtering of mass spectrometry data

    • Normalization to account for technical variation

    • Statistical testing with multiple testing correction

    • Phosphosite localization scoring

  • Differential phosphorylation analysis:

    • Identify proteins with significantly altered phosphorylation states

    • Classify by phosphorylation site type (Ser/Thr vs. His/Asp)

    • Focus on histidine-phosphorylated proteins as potential direct targets

    • Look for changes in aspartate phosphorylation in response regulators

  • Network and pathway analysis:

    • Functional enrichment of differentially phosphorylated proteins

    • Interaction network construction

    • Temporal clustering of phosphorylation changes

    • Integration with transcriptomic data

  • Validation strategies:

    • Targeted phosphorylation assays for candidate response regulators

    • Genetic interaction studies

    • Phenotypic assessment of response regulator mutants

This approach would help distinguish direct SA0216 targets from downstream effects in the phosphorylation network.

How can researchers determine the physiological relevance of SA0216 during infection?

To determine the physiological relevance of SA0216 during infection:

  • Animal infection models:

    • Compare wild-type, ΔSA0216, and complemented strains in relevant infection models

    • Assess bacterial burden, disease progression, and host survival

    • Similar to studies showing saeP and saeQ impact pathogenesis in murine bacteremia

  • Immune cell interaction studies:

    • Neutrophil survival assays with wild-type vs. mutant bacteria

    • Assessment of immune cell killing by bacterial supernatants

    • Similar to experiments showing USA300ΔsaeP has increased survival following neutrophil phagocytosis

  • Virulence factor expression analysis:

    • Measure expression of key virulence factors in wild-type vs. ΔSA0216

    • Look for differential expression in vitro vs. in vivo

    • Similar to findings that deletion of saeP resulted in increased expression of bi-component leukocidins

  • Competitive infection assays:

    • Co-infection with tagged wild-type and mutant strains

    • Determine competitive index in different tissues

    • Assess temporal changes in bacterial population composition

  • Host response analysis:

    • Immune response profiling (cytokines, immune cell recruitment)

    • Tissue damage assessment

    • Correlation with bacterial gene expression

This multi-faceted approach would help establish whether SA0216 plays a significant role during infection, similar to how the importance of SaeRS and ArlRS systems has been demonstrated .

What approach should researchers take to reconcile in vitro phosphorylation activity with in vivo phenotypes?

To reconcile in vitro phosphorylation activity with in vivo phenotypes:

  • Phosphomimetic and phosphoablative mutations:

    • Create point mutations that either prevent phosphorylation (H→A) or mimic constitutive phosphorylation

    • Compare phenotypes with wild-type and deletion mutants

    • Similar to studies with ArlR D52A showing abolished activation of the mgrA-P2 promoter

  • Stimulus-specific responses:

    • Identify conditions where the kinase is activated in vitro

    • Test whether these same conditions elicit phenotypes in vivo

    • Determine if phenotypes are absent in phosphorylation-deficient mutants

    • Similar to how ArlS was shown to be necessary for ArlR activation in response to calprotectin and glucose limitation

  • Temporal analysis:

    • Monitor kinase activity and target gene expression over time

    • Correlate with development of phenotypes

    • Establish cause-effect relationships

  • Dose-response relationships:

    • Modulate stimulus intensity in vitro and in vivo

    • Compare threshold levels for phosphorylation and phenotypic changes

    • Determine sensitivity and dynamic range

  • Compensatory mechanism identification:

    • Look for alternative pathways activated in kinase mutants

    • Determine if these explain discrepancies between biochemical activity and phenotypes

    • Similar to findings that even in the absence of ArlS, a low level of ArlR activity remained

This approach acknowledges that the relationship between phosphorylation and phenotype may be complex and context-dependent.

How does SA0216 compare structurally and functionally with characterized histidine kinases from other bacterial species?

A comparative analysis of SA0216 with characterized histidine kinases would include:

FeatureSA0216 (Predicted)SaeS (S. aureus)ArlS (S. aureus)PhoQ (E. coli)EnvZ (E. coli)
Transmembrane domainsTo be determined2Predicted22
Extracellular sensing regionTo be determined9 amino acidsPredictedLarge periplasmic domainPeriplasmic domain
Autophosphorylation siteConserved His (position to be determined)His131His242His277His243
StimulusUnknownMembrane disturbancesMn starvation, glucose limitationMg2+ limitation, antimicrobial peptidesOsmolarity changes
Cognate response regulatorTo be determinedSaeRArlRPhoPOmpR
Sensing mechanismUnknownIntramembraneTo be determinedDirect ion bindingConformational changes
Cross-talk potentialTo be determinedLimited evidenceCross-talk with GraSCross-talk with QseCLimited cross-talk

The table highlights that while core functional domains are conserved across histidine kinases, sensing mechanisms, stimuli, and regulatory targets can vary significantly. Understanding these differences is crucial for predicting SA0216 function.

What are the most promising applications for targeting SA0216 in antimicrobial research?

Potential applications for targeting SA0216 in antimicrobial research include:

  • Development of kinase inhibitors:

    • Structure-based design of small molecules targeting the ATP-binding domain

    • Allosteric inhibitors affecting conformational changes required for activation

    • Peptide-based inhibitors disrupting kinase-regulator interactions

  • Anti-virulence approaches:

    • If SA0216 regulates virulence factors, inhibiting it could attenuate pathogenicity without creating selective pressure

    • Combination therapy with conventional antibiotics

    • Target-specific adjuvants to existing treatments

  • Diagnostic applications:

    • Biomarker development based on SA0216 activity or regulon expression

    • Identification of infection stage or antibiotic susceptibility

  • Vaccine development:

    • If surface-exposed domains exist, they could be targeted for immune recognition

    • Attenuated strains with modified SA0216 activity as potential vaccine candidates

  • Host-directed therapies:

    • If SA0216 responds to specific host factors, these interactions could be disrupted

    • Manipulation of host environment to render SA0216 inactive

These applications would depend on whether SA0216 proves to be essential for virulence or survival under specific conditions, similar to how SaeRS and ArlRS have been shown to influence S. aureus pathogenesis .

What methodological advancements would significantly improve the study of histidine kinases like SA0216?

Methodological advancements that would improve histidine kinase research include:

  • Improved phosphohistidine detection tools:

    • Development of more stable phosphohistidine antibodies

    • Advanced mass spectrometry techniques for labile phosphorylations

    • Phosphohistidine-specific staining methods

  • Real-time activity monitoring:

    • FRET-based biosensors for histidine kinase conformational changes

    • Genetically encoded reporters for phosphorylation status

    • Single-molecule techniques to observe kinase-regulator interactions

  • Structural biology advancements:

    • Cryo-EM methods for membrane protein complexes

    • In situ structural determination techniques

    • Time-resolved structural studies capturing phosphorylation-induced changes

  • Genome editing refinements:

    • Conditional knockout systems for essential genes

    • Precise point mutations without marker interference

    • Multiplexed genome modification for pathway analysis

  • Systems biology integration:

    • Multi-omics data integration frameworks

    • Mathematical modeling of two-component system networks

    • Machine learning approaches for predicting kinase-regulator pairs and stimuli

These methodological advancements would address current technical limitations in studying histidine kinases and potentially accelerate characterization of proteins like SA0216.

What are the key considerations for researchers beginning work with SA0216?

Researchers beginning work with SA0216 should consider:

  • Structural and functional annotation:

    • Perform comprehensive bioinformatic analysis

    • Identify conserved domains and potential phosphorylation sites

    • Predict membrane topology and sensing mechanisms

  • Expression pattern characterization:

    • Determine conditions inducing SA0216 expression

    • Assess expression during different growth phases and infection models

    • Compare with expression patterns of known histidine kinases

  • Generation of genetic tools:

    • Create clean deletion mutants and complemented strains

    • Develop phosphorylation-deficient variants

    • Establish reporter systems for activity monitoring

  • Phenotypic characterization:

    • Screen for phenotypes in various stress conditions

    • Assess virulence in infection models

    • Evaluate interaction with host immune components

  • Integration with existing knowledge:

    • Consider potential overlap or cross-talk with SaeRS, ArlRS, and other two-component systems

    • Leverage methodologies successful with other histidine kinases

    • Place findings in the context of S. aureus pathogenesis

This systematic approach would provide a solid foundation for characterizing SA0216 and understanding its role in S. aureus biology.

How might future research directions on SA0216 evolve based on current knowledge of S. aureus histidine kinases?

Future research directions for SA0216 might include:

  • Stimulus identification:

    • Systematic screening of environmental conditions affecting SA0216 activity

    • Structure-function analysis of sensing domains

    • Comparison with stimuli sensed by other S. aureus histidine kinases

  • Regulatory network mapping:

    • Identification of cognate response regulator(s)

    • Characterization of regulated genes and processes

    • Integration into the broader S. aureus regulatory network

  • Cross-talk and redundancy analysis:

    • Investigation of functional overlap with other two-component systems

    • Examination of compensatory mechanisms in SA0216 mutants

    • Evaluation of cross-phosphorylation with non-cognate partners

  • Role in virulence and persistence:

    • Assessment of contribution to various infection types

    • Evaluation of impact on antibiotic tolerance and resistance

    • Investigation of role in biofilm formation and chronic infection

  • Therapeutic targeting:

    • Development of specific inhibitors

    • Evaluation as a potential vaccine target

    • Exploration of combination therapies targeting multiple two-component systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.