Recombinant Staphylococcus aureus Uncharacterized sensor-like histidine kinase SAB0162c (SAB0162c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
hptS; SAB0162c; Sensor protein kinase HptS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-518
Protein Length
full length protein
Species
Staphylococcus aureus (strain bovine RF122 / ET3-1)
Target Names
SAB0162c
Target Protein Sequence
MTAYKPYRHQLRRSLFASTIFPVFLVIIIGLVSFYAIYIWIEHRTIHQHVNESQSSLHHI EKQIQTFITQHNNSFQELDLTNHHDVTATKRELLKLIHQQPATLYYELSGPNQFITNNYE HLNTKNMYLFSTHQLKFKNSTYMLKIYMANTPRLSEIKKDSRQFALIVDRYDNILYANDD RFTIGEKYRPQQFGFMNESVKLNHANHRLIIYKDIHENIEDGITLLIVMAVVLVLLVIFG FISADNMAKRQTKDIETIIQKIYYAKNRHLGTYTPLKNNSELEEINNYIYDLFESNEQLI HSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQYLITLSPKLAQTVVQQLSQMLRYSL RTNSHTVELNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMMLQPLIENAIK HGRDTESLDITIRLTLARQNLHVLVCDNGIGMSSSRLQYVRQSLNNDVFDTKHLGLNHLH NKAMIQYGSHARLHIFSKRNLGTLICYKIPLSRGNVDV
Uniprot No.

Target Background

Function
SAB0162c is a member of the two-component regulatory system HptS/HptR in *Staphylococcus aureus*. This system regulates genes involved in hexose phosphate transport in response to extracellular phosphate levels. SAB0162c likely functions as a sensor protein kinase, autophosphorylating at a histidine residue and subsequently transferring the phosphate group to a conserved aspartic acid residue within the HptS regulatory domain. HptS, in turn, modulates CcpA-dependent transcription of genes impacting antibiotic susceptibility.
Database Links

KEGG: sab:SAB0162c

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of SAB0162c?

SAB0162c is a sensor-like histidine kinase from Staphylococcus aureus strain bovine RF122/ET3-1, with a UniProt identifier of Q2YV55. The protein contains 518 amino acids with a complete sequence comprised of multiple domains typical of bacterial histidine kinases . The structure includes transmembrane regions indicated by the hydrophobic sections in its sequence (particularly the N-terminal region containing "PVFLVIIIGLVSFYAIY"), sensor domains that likely detect environmental signals, and catalytic domains responsible for phosphotransfer activity (EC 2.7.13.3) . Based on the sequence analysis, SAB0162c likely contains HAMP domains (present in Histidine kinases, Adenylyl cyclases, Methyl-accepting proteins, and Phosphatases) that connect the sensor and kinase domains, similar to other characterized histidine kinases .

How does SAB0162c compare to well-characterized histidine kinases?

While SAB0162c remains uncharacterized, comparing its sequence and domain organization with well-studied histidine kinases such as PhoQ provides valuable insights into its potential function. Like PhoQ, SAB0162c likely contains sensor domains that detect specific environmental signals, transmembrane helices that span the cell membrane, and cytoplasmic domains involved in signal transduction . The protein sequence contains conserved histidine residues typical of the HisKA (histidine kinase A) domain, which serve as sites for autophosphorylation during signal transduction . Similar to characterized histidine kinases, SAB0162c likely functions through conformational changes that propagate signals from the sensor domain to the autokinase domain, leading to downstream effects that regulate bacterial responses to environmental conditions .

What is the predicted function of SAB0162c based on sequence homology?

Based on sequence homology and the presence of conserved domains typical of histidine kinases, SAB0162c likely functions as a sensor protein in a two-component signaling system. The protein contains domains consistent with environmental sensing capabilities and a histidine kinase catalytic domain (EC 2.7.13.3) . Its transmembrane regions and sensor domains suggest it may detect changes in the extracellular environment, such as alterations in ion concentrations, pH, or the presence of specific compounds. Upon signal detection, the protein likely undergoes autophosphorylation at conserved histidine residues and transfers the phosphoryl group to a response regulator, which then mediates changes in gene expression or cellular processes . The specific stimuli that activate SAB0162c remain unknown, but its presence in a bovine-associated S. aureus strain suggests possible roles in adaptation to the bovine host environment.

What experimental approaches can determine the specific environmental stimuli sensed by SAB0162c?

Determining the stimuli that activate SAB0162c requires systematic experimental approaches combining molecular biology, biochemistry, and biophysical techniques:

Cysteine-crosslinking assays: Following approaches similar to those used with PhoQ, researchers can introduce cysteine mutations at strategic positions in SAB0162c and monitor conformational changes under different conditions . This method can detect changes in protein structure upon exposure to potential stimuli.

Reporter gene assays: Constructing transcriptional fusions between SAB0162c-regulated promoters and reporter genes (like lacZ or GFP) allows measurement of kinase activity in response to various stimuli . The experimental design should:

  • Create reporter constructs with suspected target promoters

  • Expose bacterial cultures to a matrix of potential stimuli

  • Measure reporter gene expression using appropriate assays

  • Normalize results against controls to identify specific activating conditions

Phosphotransfer profiling: In vitro reconstitution of phosphotransfer between purified SAB0162c and potential response regulators can help identify cognate partners and conditions affecting activity .

A structured experimental approach would expose the SAB0162c system to various environmental conditions (pH changes, ion concentrations, antimicrobial compounds, bovine-specific factors) while monitoring activation through these complementary methods.

How do mutations in the signal transduction pathway of SAB0162c affect its sensor and autokinase functions?

Mutations along the signal transduction pathway of histidine kinases like SAB0162c can have diverse effects on protein function, from complete inactivation to constitutive activation. Based on studies of related proteins, researchers should consider:

Strategic mutagenesis approaches:

  • Alanine and phenylalanine substitutions in the protein core can alter the relative energetics of kinase-active versus phosphatase-promoting states by changing packing geometry

  • Tryptophan substitutions in transmembrane helices can impact signal transduction at the membrane interface

  • Glycine insertions can disrupt helical continuity and decouple sensor domains from effector domains

The effects of such mutations can be assessed through:

  • Cysteine-crosslinking assays to measure sensor domain conformational changes

  • Autophosphorylation assays to assess kinase activity

  • Phosphatase activity measurements

  • Reporter gene expression to evaluate downstream signaling

Table 1: Predicted effects of mutations at different positions in SAB0162c

DomainMutation TypeExpected Effect on Sensor ActivityExpected Effect on Kinase Activity
Periplasmic sensorConservative substitutionsMinimal effectMinimal effect
Periplasmic sensorNon-conservative substitutionsAltered ligand binding specificityIndirect effects through sensor coupling
Transmembrane helixAromatic substitutionsAltered transmembrane signalingDecreased signal transmission
HAMP domainAlanine substitutionsAltered conformational dynamicsChanged bias between active/inactive states
Catalytic domainHistidine site mutationsNo direct effectAbolished autophosphorylation
Interdomain linkersGlycine insertionsConformational decouplingDisrupted signal transmission

These experiments would reveal which regions are critical for maintaining proper coupling between sensor and autokinase functions, similar to findings with other histidine kinases .

What is the relationship between SAB0162c and virulence in Staphylococcus aureus bovine infections?

The presence of SAB0162c in S. aureus strain bovine RF122/ET3-1 suggests possible involvement in bovine host adaptation or virulence. Investigating this relationship requires multi-faceted approaches:

Gene deletion studies: Creating SAB0162c knockout mutants and testing them in:

  • In vitro models of bovine immune cell interactions

  • Ex vivo bovine tissue models

  • In vivo bovine infection models where ethically approved

Transcriptomics: Comparing gene expression profiles between wild-type and SAB0162c mutants under conditions mimicking bovine environments to identify regulated genes.

Phenotypic assays: Assessing the impact of SAB0162c deletion on:

  • Biofilm formation capability

  • Resistance to bovine antimicrobial peptides

  • Survival in bovine milk

  • Adherence to bovine epithelial cells

  • Metabolic adaptation to bovine-specific nutrients

Comparative genomics: Analyzing the presence and sequence conservation of SAB0162c across S. aureus strains with varying host specificity and virulence profiles to identify correlations with bovine adaptation.

The experimental design should include appropriate controls, statistical validation, and complementary approaches to establish causative relationships between SAB0162c activity and virulence phenotypes.

What expression systems are optimal for producing functional recombinant SAB0162c for structural and biochemical studies?

Producing functional recombinant SAB0162c presents challenges due to its transmembrane domains and potential toxicity to expression hosts. The optimal approach requires careful consideration of expression systems:

E. coli-based expression systems:

  • BL21(DE3) derivatives with additional rare tRNA genes for codon optimization

  • C41/C43 strains specifically designed for membrane protein expression

  • Fusion tags to enhance solubility (MBP, SUMO, TrxA)

  • Inducible promoters with tight regulation (T7lac, araBAD)

Expression vector design:

  • Inclusion of appropriate affinity tags (His6, FLAG) for purification

  • Consideration of domain-based expression for difficult regions

  • Incorporation of TEV or other protease cleavage sites for tag removal

  • Codon optimization for E. coli expression

Expression conditions optimization:

  • Lower temperatures (16-20°C) to allow proper folding

  • Reduced inducer concentrations to prevent aggregation

  • Inclusion of specific additives (glycerol, specific detergents) in growth media

  • Testing both LB and defined media for optimal yields

Protein extraction and purification:

  • Membrane protein-specific detergents (DDM, LMNG, Digitonin)

  • Mixed micelle approaches

  • Purification under conditions that maintain native conformations

For structural studies, expression of individual domains might prove more tractable than the full-length protein, particularly for crystallography purposes. For biochemical studies requiring full-length protein, nanodiscs or proteoliposomes could be used to maintain the native membrane environment after purification.

How can researchers design comprehensive experimental protocols to characterize SAB0162c signal transduction mechanisms?

Characterizing the signal transduction mechanism of SAB0162c requires a systematic experimental design approach that integrates multiple techniques:

Experimental Design Framework:

  • Baseline Activity Determination:

    • In vitro autophosphorylation assays under standard conditions

    • Phosphatase activity measurements

    • Background gene expression profiling in wild-type cells

  • Signal Response Characterization:

    • Matrix-based screening of potential environmental stimuli

    • Dose-response relationships for identified activators/inhibitors

    • Temporal dynamics of activation and adaptation

  • Structural Dynamics Analysis:

    • Cysteine scanning mutagenesis across key domains

    • FRET-based sensors to monitor conformational changes in real-time

    • Hydrogen-deuterium exchange mass spectrometry to identify regions undergoing conformational changes

  • Coupling Mechanism Investigation:

    • Domain swapping with characterized histidine kinases

    • Introduction of glycine linkers between domains to assess coupling requirements

    • Mutational analysis of interface residues between domains

Table 2: Experimental design for comprehensive characterization of SAB0162c signal transduction

Research QuestionExperimental ApproachControlsMeasurementsData Analysis
What activates SAB0162c?Environmental condition screeningNon-stimulated baseline, PhoQ-positive controlAutophosphorylation levels, Reporter activityZ-score normalization, Principal component analysis
How does the signal propagate?Cysteine crosslinking assay at different domain junctionsWild-type protein, Non-crosslinkable mutantsCrosslinking efficiency under varying conditionsCorrelation analysis with activation state
What residues are critical for coupling?Alanine scanning mutagenesisWild-type protein, Known functional mutantsActivity measurements for each mutantClustering analysis of phenotypically similar mutants
What conformational changes occur?HDX-MS under activating/non-activating conditionsDenatured protein controlsDeuterium incorporation patternsDifferential analysis between states

This comprehensive approach incorporates multiple lines of evidence, appropriate controls, and rigorous data analysis to characterize the signal transduction mechanisms of SAB0162c .

What are the optimal assays for measuring SAB0162c phosphorylation states and activity in vitro and in vivo?

Accurately measuring the phosphorylation states and activity of SAB0162c requires complementary assays for both in vitro biochemical characterization and in vivo functional assessment:

In Vitro Phosphorylation Assays:

  • Radioactive phosphorylation assays:

    • Incubation of purified SAB0162c with [γ-32P]ATP

    • Time-course analysis of autophosphorylation

    • Phosphotransfer to candidate response regulators

    • Quantification via SDS-PAGE and autoradiography/phosphorimaging

  • Phos-tag SDS-PAGE:

    • Non-radioactive separation of phosphorylated and non-phosphorylated species

    • Western blotting with anti-His or protein-specific antibodies

    • Densitometric analysis of phosphorylated fraction

  • Mass spectrometry-based approaches:

    • Identification of phosphorylation sites

    • Quantification of phosphorylation stoichiometry

    • Monitoring of phosphorylation dynamics

In Vivo Activity Assays:

  • Transcriptional reporter fusions:

    • Beta-galactosidase assays for lacZ fusions

    • Fluorescence measurements for GFP/mCherry fusions

    • Luciferase-based reporters for real-time monitoring

  • Phosphorylation-specific antibodies:

    • Development of antibodies recognizing phosphorylated histidine

    • Western blotting of cell lysates under native conditions

  • Genetic complementation assays:

    • Rescue of phenotypes in deletion mutants

    • Comparison of wild-type and phosphotransfer-deficient variants

  • Protein-protein interaction assays:

    • Bacterial two-hybrid systems

    • Co-immunoprecipitation of kinase-regulator complexes

    • FRET/BRET approaches for real-time interaction monitoring

For all assays, rigorous experimental design must include appropriate positive and negative controls, validation of specificity, and optimization of assay conditions to ensure reliability and reproducibility of results .

How should researchers analyze contradictory data in SAB0162c functional studies?

Contradictory data in functional studies of uncharacterized proteins like SAB0162c is not uncommon and requires systematic approaches to resolve discrepancies:

Root Cause Analysis Framework:

  • Experimental Condition Variations:

    • Systematically compare buffer compositions, temperature, pH, and ionic conditions

    • Evaluate the impact of different protein preparations or expression systems

    • Consider the effects of tags, fusion partners, or truncations on protein behavior

  • Technique-Specific Limitations:

    • Assess whether different methods are measuring the same or different aspects of function

    • Evaluate the sensitivity and specificity of each assay

    • Consider time resolution differences between techniques

  • Strain or Genetic Background Effects:

    • Compare results across different bacterial strains or genetic backgrounds

    • Screen for suppressor mutations that might affect phenotypes

    • Consider polar effects in genetic manipulation experiments

  • Data Integration Approaches:

    • Develop mathematical models to reconcile seemingly contradictory observations

    • Use Bayesian statistical frameworks to weigh evidence from different sources

    • Implement machine learning approaches to identify patterns across datasets

When facing contradictory data, researchers should:

  • Design critical experiments that directly test competing hypotheses

  • Collaborate with groups using complementary approaches

  • Consider that apparent contradictions may reflect complex regulatory mechanisms rather than experimental errors

A specific example might be contradictory results between in vitro biochemical activity and in vivo reporter assays. This could be resolved by:

  • Measuring protein stability and expression levels in vivo

  • Assessing the impact of cellular factors absent in vitro

  • Evaluating the specificity of reporter systems

  • Testing intermediate conditions that bridge the gap between simplified in vitro and complex in vivo environments

What computational approaches can predict SAB0162c interaction partners and regulatory networks?

Computational approaches offer powerful methods to predict interaction partners and regulatory networks of SAB0162c, guiding experimental validation:

Sequence-Based Methods:

  • Co-evolution analysis:

    • Direct coupling analysis (DCA) to identify co-evolving residues between SAB0162c and potential partners

    • Statistical coupling analysis (SCA) to detect evolutionary constraints

    • Mutual information approaches to detect correlated mutations

  • Genomic context methods:

    • Gene neighborhood analysis across bacterial genomes

    • Gene fusion detection

    • Phylogenetic profiling to identify proteins with similar evolutionary patterns

Structure-Based Predictions:

  • Homology modeling:

    • Generate structural models based on related histidine kinases

    • Dock potential response regulators to identify compatible interfaces

    • Molecular dynamics simulations to assess stability of predicted complexes

  • Interface prediction:

    • Identification of surface patches with characteristics of protein-protein interfaces

    • Conservation mapping to identify functionally important regions

    • Electrostatic complementarity analysis

Network-Based Approaches:

  • Guilt-by-association methods:

    • Integration of transcriptomic data to identify co-regulated genes

    • Protein-protein interaction network analysis

    • Metabolic network context

  • Machine learning integration:

    • Random forest or support vector machine classifiers trained on known histidine kinase-response regulator pairs

    • Deep learning approaches incorporating multiple data types

    • Bayesian network models to predict regulatory relationships

Table 3: Computational prediction methods for SAB0162c interactions

Method CategorySpecific ApproachInput DataExpected OutputValidation Strategy
Sequence-basedGenomic contextGenome sequences across Staphylococcus speciesGene clusters potentially functionally related to SAB0162cCo-immunoprecipitation of predicted partners
Structure-basedHomology modeling & dockingSAB0162c sequence, structural templates3D models of SAB0162c-regulator complexesMutagenesis of predicted interface residues
Network-basedCo-expression analysisTranscriptomic data under various conditionsGenes with expression patterns correlated with SAB0162c targetsChIP-seq of response regulators to verify targets
Integrated approachMachine learning classifierCombined sequence, structure, and genomic featuresRanked list of potential interaction partnersBacterial two-hybrid screening of top candidates

These computational predictions should guide targeted experimental validations rather than being treated as definitive results .

How can researchers integrate multi-omics data to comprehensively understand SAB0162c function in S. aureus physiology?

A comprehensive understanding of SAB0162c function requires integration of multiple omics datasets through a systems biology approach:

Multi-omics Data Collection:

  • Genomics:

    • Comparative genomics across S. aureus strains with different host specificities

    • Genetic variation analysis of SAB0162c across isolates

    • Identification of genomic context and conserved synteny

  • Transcriptomics:

    • RNA-seq comparing wild-type and SAB0162c mutants under various conditions

    • Time-course analysis following activation or inhibition

    • Single-cell RNA-seq to capture population heterogeneity

  • Proteomics:

    • Global proteome analysis to identify changes in protein abundance

    • Phosphoproteomics to map signaling cascades

    • Protein-protein interaction studies (AP-MS) to identify physical interactors

  • Metabolomics:

    • Targeted and untargeted metabolite profiling

    • Flux analysis using isotope labeling

    • Identification of metabolic pathways affected by SAB0162c activity

Data Integration Strategies:

  • Correlation networks:

    • Construction of co-expression networks across multiple datasets

    • Identification of modules associated with SAB0162c function

    • Network topology analysis to identify key regulatory nodes

  • Causal inference methods:

    • Bayesian networks to infer directional relationships

    • Granger causality testing for time-series data

    • Intervention calculus to distinguish direct from indirect effects

  • Pathway enrichment approaches:

    • Gene Set Enrichment Analysis (GSEA) across multiple omics layers

    • Pathway-level integration of heterogeneous data types

    • Visualization of integrated pathways with tools like Cytoscape

  • Predictive modeling:

    • Machine learning models to predict phenotypic outcomes

    • Constraint-based modeling incorporating regulatory information

    • Dynamic models of SAB0162c-regulated processes

An effective experimental design would include:

  • Collection of samples for multiple omics analyses from the same experimental batches

  • Careful attention to time points that capture both immediate and adaptive responses

  • Inclusion of appropriate perturbations that activate or inhibit SAB0162c

  • Rigorous statistical approaches that account for the high-dimensional nature of omics data

This integrated approach allows researchers to move beyond associative observations to causal understanding of SAB0162c's role in S. aureus physiology and potential contributions to virulence or host adaptation .

What are the most promising approaches for developing inhibitors targeting SAB0162c for potential antimicrobial applications?

Developing inhibitors targeting SAB0162c represents a potential novel approach to antimicrobial development, particularly for bovine S. aureus infections. The most promising approaches include:

Structure-Based Drug Design:

  • Determination of high-resolution structures of SAB0162c domains through X-ray crystallography or cryo-EM

  • Identification of druggable pockets using computational solvent mapping

  • Virtual screening of compound libraries against identified binding sites

  • Fragment-based approaches to develop high-affinity ligands

Function-Based Screening:

  • Development of high-throughput assays measuring SAB0162c autophosphorylation

  • Screening of natural product libraries, particularly from sources that naturally interact with S. aureus

  • Repurposing screens of approved drugs that may have secondary activity against histidine kinases

  • Phenotypic screens identifying compounds that mimic SAB0162c deletion phenotypes

Peptide-Based Inhibitors:

  • Design of peptides that interfere with dimerization or kinase-regulator interactions

  • Stapled peptides to enhance stability and cell penetration

  • Peptidomimetics that maintain critical binding interactions with improved pharmacological properties

The development pathway should include:

  • Initial in vitro validation of binding and inhibitory activity

  • Assessment of selectivity against human kinases

  • Evaluation of effects on S. aureus growth and virulence

  • Testing in relevant infection models, particularly bovine systems

  • Optimization of pharmacokinetic properties for potential therapeutic applications

This research direction could yield novel antimicrobials with specificity for bovine S. aureus strains, potentially addressing the significant problem of bovine mastitis caused by this pathogen .

How might the function of SAB0162c compare across different Staphylococcus aureus strains and related bacterial species?

Comparative analysis of SAB0162c across different S. aureus strains and related species can provide crucial insights into its evolutionary significance and functional adaptation:

Cross-Strain Comparative Genomics:

  • Sequence comparison of SAB0162c homologs across human, bovine, and other host-adapted S. aureus strains

  • Analysis of selection pressures acting on different domains (sensor vs. catalytic)

  • Identification of strain-specific variations that might correlate with host adaptation

Functional Comparison:

  • Expression and purification of SAB0162c homologs from diverse strains

  • Comparative biochemical characterization of activity and substrate specificity

  • Cross-complementation experiments in deletion mutants from different strains

  • Analysis of differences in stimulus detection and response kinetics

Evolutionary Context:

  • Phylogenetic analysis of SAB0162c in the context of two-component system evolution

  • Examination of gene neighborhood conservation or variability

  • Assessment of horizontal gene transfer events involving SAB0162c or its genomic context

  • Comparison with homologous systems in other Gram-positive pathogens

Table 4: Predicted functional differences in SAB0162c across S. aureus lineages

S. aureus LineageHost AdaptationPredicted Sensor Domain VariationsPotential Functional Differences
Human-associated clonal complexesHuman hostsPotential variations in extracellular sensing domainMay respond to human-specific antimicrobial peptides or immune factors
Bovine-adapted strains (RF122)Bovine hostsSequence variations in sensing loopsLikely tuned to detect bovine-specific environmental cues
Small ruminant strainsOvine/caprine hostsIntermediate sequencesPotentially broader detection range
Avian-adapted strainsPoultrySignificant sensing domain divergenceMay detect distinct conditions in avian hosts

This comparative approach would not only provide insights into the specific function of SAB0162c in bovine S. aureus strains but also contribute to our broader understanding of how two-component systems evolve during host adaptation processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.