Recombinant Staphylococcus aureus Uncharacterized sensor-like histidine kinase SACOL0202 (SACOL0202)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
hptS; SACOL0202; Sensor protein kinase HptS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-518
Protein Length
full length protein
Species
Staphylococcus aureus (strain COL)
Target Names
SACOL0202
Target Protein Sequence
MTAYKPYRHQLRRSLFASTIFPVFLVIIIGLVSFYAIYIWIEHRTIHQHVDESQSSLHHT EKQIQTFITQHNNSFQELDLTNHHDVTATKRELLKLIHQQPATLYYELSGPNQFITNNYE HLNTKNMYLFSTHQLKFKNSTYMLKIYMANTPRLSEIKKDNRQFALIVDQYDNILYANDD RFTIGEKYRPQQFGFMNESVKLNHADHRLIIYKDIHENIEDGITLLIVMAVVLVLLVIFG FISADNMAKRQTKDIETIIQKIYYAKNRHLGTYTPLKNNSELEEINNYIYDLFESNEQLI HSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQYLITLSPKLAQTVVQQLSQMLRYSL RTNSHTVELNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMMLQPLIENAIK HGRDTESLDITIRLTLARQNLHVLVCDNGIGMSSSRLQYVRQSLNNDVFDTKHLGLNHLH NKAMIQYGSHARLHIFSKRNQGTLICYKIPLSRGNVDV
Uniprot No.

Target Background

Function
Recombinant Staphylococcus aureus Uncharacterized sensor-like histidine kinase SACOL0202 (SACOL0202) is a member of the two-component regulatory system HptS/HptR. This system regulates genes involved in hexose phosphate transport in response to extracellular phosphate levels. SACOL0202 likely functions as a sensor protein kinase, autophosphorylating at a histidine residue before transferring the phosphate group to the conserved aspartic acid residue in the HptS regulatory domain. HptS, in turn, antagonizes CcpA-dependent transcription of genes involved in antibiotic susceptibility.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of SACOL0202 in Staphylococcus aureus?

SACOL0202 is a putative sensor histidine kinase (HK) that forms part of a two-component regulatory system (TCS) with SACOL0201. Like other sensor HKs, it likely contains conserved cytoplasmic phosphorylation and ATP-binding kinase domains, connected to a transmembrane segment through a coiled-coil region . The protein presumably functions as a multifunctional enzyme with autokinase, phosphotransfer, and phosphatase activities, similar to other histidine kinases in the GHKL superfamily (GyraseB, Hsp90, histidine kinases, and MutL) .

The structure of SACOL0202 likely includes several functional domains:

  • A sensor domain (likely extracellular) that detects environmental signals

  • A transmembrane region anchoring the protein to the cell membrane

  • A HAMP linker domain (histidine kinase, adenylyl cyclase, methyl-accepting chemotaxis proteins and phosphatase) that transmits signals between the external input domain and the cytoplasmic output module

  • A DHp domain (dimerization and histidine phosphotransfer) containing the conserved histidine residue that gets phosphorylated

  • A CA domain (catalytic and ATP-binding) that catalyzes the transfer of a phosphoryl group from ATP to the histidine residue

How does the SACOL0202/SACOL0201 two-component system function in signal transduction?

The SACOL0202/SACOL0201 two-component system likely functions similarly to other bacterial TCS. When the sensor domain of SACOL0202 detects specific environmental stimuli, the protein undergoes ATP-dependent autophosphorylation at a conserved histidine residue in the DHp domain . This phosphoryl group is then transferred to a conserved aspartate residue in the response regulator SACOL0201, which modulates gene expression in response to the detected signal .

The mechanism follows these steps:

  • Signal detection by the sensor domain

  • Conformational change transmitted through the HAMP linker

  • Autophosphorylation of the conserved histidine residue

  • Phosphotransfer to the response regulator SACOL0201

  • Activation of SACOL0201, leading to gene expression changes

Recent research suggests that this system may be involved in virulence regulation in S. aureus, though the specific stimuli sensed by SACOL0202 remain uncharacterized .

What expression systems are most effective for producing recombinant SACOL0202?

For producing recombinant SACOL0202, several expression systems can be considered based on insights from related histidine kinase studies. Effective expression typically involves:

  • E. coli-based expression systems: Using pET vectors with T7 promoters in BL21(DE3) or Rosetta strains . Expression parameters typically include:

    • IPTG concentration: 0.1-0.5 mM

    • Induction temperature: 16-25°C (to prevent inclusion body formation)

    • Induction time: 12-18 hours

  • Protein solubility considerations: For membrane-bound portions, consider expressing only the cytoplasmic domain (similar to the approach with HK853-CD from T. maritima) . Alternatively, use detergents like n-dodecyl-β-D-maltoside (DDM) for full-length protein extraction.

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) using His-tags

    • Ion-exchange chromatography

    • Size exclusion chromatography

Expression SystemAdvantagesChallengesYield Potential
E. coli BL21(DE3)High yield, easy handlingPotential inclusion bodies5-15 mg/L culture
E. coli RosettaBetter for rare codonsLower yield3-10 mg/L culture
Cell-free systemsMembrane protein friendlyExpensive, technically demanding1-3 mg/10 mL reaction

What methodologies can identify the specific environmental signals detected by SACOL0202?

Identifying the specific signals detected by SACOL0202 requires a multi-pronged approach:

  • Comparative genomic analysis: Align SACOL0202 with characterized sensor histidine kinases to predict potential sensing modalities based on sensor domain homology.

  • Phosphorylation assays under varying conditions: Expose purified SACOL0202 to different potential signals (pH changes, antimicrobial peptides, osmotic stress, etc.) and measure autophosphorylation activity using [γ-32P]ATP . Systematically test conditions found in the host environment during S. aureus infection.

  • Transcriptomic profiling: Compare wild-type S. aureus with SACOL0202 deletion mutants under various conditions to identify differentially expressed genes, revealing potential sensing pathways .

  • Bacterial two-hybrid systems: Identify interaction partners of the sensor domain that might provide clues about the detected signals.

  • Crystallography with potential ligands: Determine the structure of the sensor domain in complex with candidate molecules to identify binding interactions .

A methodological workflow should include:

  • High-throughput screening of potential signals using fluorescence-based phosphorylation reporters

  • Validation of candidate signals using in vitro biochemical assays

  • Confirmation in vivo using reporter strains expressing fluorescent proteins under the control of SACOL0201-regulated promoters

How does SACOL0202 contribute to S. aureus virulence and antibiotic resistance?

Evidence suggests that the SACOL0202/SACOL0201 two-component system may play a significant role in S. aureus virulence regulation . To investigate this connection:

  • Infection models: Compare the virulence of wild-type S. aureus with SACOL0202 deletion or point mutants in various animal models (murine bacteremia, skin infection, pneumonia). Assess metrics such as bacterial load, tissue damage, and survival rates.

  • Transcriptomic analysis: Network analysis of S. aureus response to antibiotics like ramoplanin has revealed modules for virulence factors that may involve SACOL0202 . Perform RNA-seq comparing wild-type and SACOL0202 mutants under infection-relevant conditions.

  • Phosphoproteomics: Identify phosphorylation targets of SACOL0201 to map the regulon controlled by this two-component system.

  • Antibiotic susceptibility testing: Determine minimum inhibitory concentrations (MICs) for various antibiotics against wild-type and SACOL0202 mutant strains to assess its role in resistance.

  • Host-pathogen interaction assays: Evaluate the ability of SACOL0202 mutants to survive in human neutrophils, adhere to epithelial cells, and form biofilms.

Recent research has shown connections between certain metabolic pathways and virulence mechanisms in S. aureus . Investigating whether SACOL0202 regulates both metabolism and virulence could provide insights into its role in pathogenesis.

How can contradictory data on SACOL0202 function be reconciled through experimental design?

Resolving contradictory data on SACOL0202 function requires systematic experimental approaches:

  • Strain-specific variations: Different S. aureus strains may exhibit varying dependence on SACOL0202. Use isogenic backgrounds for all experiments and test multiple well-characterized strains (USA300, Newman, COL, etc.).

  • Growth and environmental conditions: Standardize growth media, temperature, oxygen levels, and growth phase for all experiments. Test function under multiple conditions to reveal condition-specific effects.

  • Genetic complementation: For knockout studies showing conflicting results, perform genetic complementation with wild-type SACOL0202 under native promoter control to confirm phenotype restoration.

  • Domain-specific mutations: Create point mutations in key functional domains (sensor, HAMP, DHp, CA) to dissect specific activities . Test the effects on:

    • Autophosphorylation (H→A mutation in phosphoacceptor histidine)

    • ATP binding (mutations in conserved N, G1, F, G2 boxes of the CA domain)

    • Signal detection (mutations in the predicted sensor domain)

  • Combinatorial genetic approaches: Create double mutants with other regulatory systems to identify redundancy or antagonism that might explain contradictory results.

  • Temporal dynamics: Monitor SACOL0202 activity over time using time-resolved experiments, as transient activation might be missed in endpoint analyses.

DomainKey Residues to MutateExpected EffectValidation Method
SensorConserved hydrophobic residuesLoss of signal detectionIn vitro phosphorylation assay
HAMPConserved glycine hingesSignal transmission defectStructure analysis, phosphotransfer assay
DHpConserved histidineLoss of phosphorylation32P incorporation assay
CAATP-binding motifsLoss of kinase activityATPase assay, thermal shift

What are the optimal protocols for assessing SACOL0202 phosphorylation dynamics in vitro?

To assess SACOL0202 phosphorylation dynamics in vitro:

  • Protein preparation:

    • Express the cytoplasmic portion of SACOL0202 with a cleavable affinity tag

    • Purify using a three-step chromatography process (IMAC, ion exchange, size exclusion)

    • Verify purity by SDS-PAGE and confirm identity by mass spectrometry

    • Concentrate to 1-5 mg/mL in phosphorylation buffer (50 mM Tris-HCl pH 8.0, 50 mM KCl, 10 mM MgCl₂)

  • Autophosphorylation assay:

    • Incubate purified SACOL0202 (1-5 μM) with [γ-32P]ATP (50-100 μM)

    • Sample at various time points (0, 1, 5, 15, 30, 60 min)

    • Quench reactions with SDS-PAGE loading buffer containing EDTA

    • Resolve by SDS-PAGE and visualize using phosphorimaging

  • Phosphotransfer assay:

    • Pre-phosphorylate SACOL0202 as above

    • Add purified SACOL0201 response regulator

    • Monitor phosphotransfer kinetics by sampling at various time points

    • Analyze by SDS-PAGE and phosphorimaging

  • Phosphatase activity assessment:

    • Pre-phosphorylate SACOL0201 using small molecule phosphodonors (e.g., acetyl phosphate)

    • Add non-phosphorylated SACOL0202

    • Monitor dephosphorylation of SACOL0201 over time

  • Quantitative analysis:

    • Use densitometry to quantify 32P incorporation

    • Calculate rate constants for autophosphorylation, phosphotransfer, and dephosphorylation

    • Perform experiments in triplicate for statistical robustness

For monitoring the effects of potential signal molecules, include these in the reaction buffer at physiologically relevant concentrations and compare phosphorylation kinetics to baseline conditions.

How can CRISPR-Cas9 be optimized for studying SACOL0202 function in S. aureus?

Optimizing CRISPR-Cas9 for studying SACOL0202 in S. aureus requires addressing several technical challenges:

  • Vector selection and design:

    • Use temperature-sensitive plasmids (e.g., pIMAY) for S. aureus transformation

    • Employ inducible promoters (e.g., tetR-regulated) to control Cas9 expression

    • Include homology arms (500-1000 bp) flanking the SACOL0202 gene

  • sgRNA design considerations:

    • Select target sequences with minimal off-target effects using algorithms specific for S. aureus genome

    • Target conserved regions within SACOL0202 for gene knockout

    • For domain-specific studies, target regions encoding functional domains while preserving reading frame

  • Delivery optimization:

    • Electroporation parameters: 2.5 kV, 25 μF, 100 Ω for S. aureus RN4220

    • Pre-treat cells with lysostaphin (limited digestion) to enhance DNA uptake

    • Recover cells in BHI media supplemented with 0.5 M sucrose

  • Selection and screening strategies:

    • Use two-step selection process: first select for plasmid integration, then counterselect for plasmid excision

    • Screen mutants by colony PCR and Sanger sequencing

    • Verify changes in expression using RT-qPCR

  • Types of genetic modifications:

    • Complete gene deletion (for loss-of-function studies)

    • Point mutations in key functional residues (for structure-function analyses)

    • Epitope tagging (for protein localization and interaction studies)

    • Promoter replacements (for controlled expression)

Modification TypesgRNA Target LocationHomology Arm DesignVerification Method
Gene knockoutCoding sequence startUpstream/downstream of genePCR across deletion junction
Point mutationNear target codonInclude desired mutationRFLP or sequencing
Domain deletionDomain boundariesIn-frame fusion pointsWestern blot (size shift)
Reporter fusionC-terminusPreserve reading frameFluorescence/activity assay

What are the most effective approaches for identifying the downstream regulon of the SACOL0202/SACOL0201 system?

To comprehensively identify the downstream regulon of the SACOL0202/SACOL0201 two-component system:

  • Transcriptomic profiling:

    • Compare gene expression profiles between wild-type, ΔSACOL0202, ΔSACOL0201, and phosphorylation-deficient point mutants

    • Perform RNA-seq under various conditions (exponential growth, stationary phase, low pH, antibiotic stress)

    • Use time-course experiments after system activation to capture early, intermediate, and late regulated genes

  • Chromatin immunoprecipitation sequencing (ChIP-seq):

    • Create epitope-tagged SACOL0201 constructs (C-terminal FLAG or HA tag)

    • Perform ChIP-seq to identify direct binding sites of SACOL0201 throughout the genome

    • Compare binding profiles under activating vs. non-activating conditions

  • Protein-DNA interaction studies:

    • Express and purify recombinant SACOL0201

    • Perform electrophoretic mobility shift assays (EMSAs) with predicted binding sites

    • Use DNase I footprinting to precisely map binding sequences

    • Determine the consensus binding motif for SACOL0201

  • Reporter gene assays:

    • Clone promoters of putative target genes upstream of reporters (e.g., lacZ, lux)

    • Test activity in wild-type vs. mutant backgrounds

    • Validate direct regulation through targeted mutagenesis of predicted binding sites

  • Integrative network analysis:

    • Combine transcriptomic data, ChIP-seq results, and protein interaction studies

    • Use computational approaches to construct comprehensive regulatory networks

    • Identify enriched functional categories among regulated genes

What crystallization conditions have proven successful for histidine kinases similar to SACOL0202?

Based on successful crystallization of related histidine kinases, the following approaches may be effective for SACOL0202:

DomainRecommended ConstructCrystallization StrategySimilar Structures
Cytoplasmic (DHp+CA)aa ~232-489 (based on homology)PEG 3350 + ADP-βNT. maritima HK853-CD (PDB: 2C2A)
HAMPDomain boundaries from alignmentHigh salt, pH 7.5A. fulgidus AF1503 HAMP (PDB: 2L7H)
SensorPredicted extracellular domainSparse matrix screeningVarious PAS/GAF domains

How can protein-protein interactions involving SACOL0202 be comprehensively mapped in S. aureus?

To map the protein-protein interaction network of SACOL0202 in S. aureus:

  • In vivo approaches:

    • Bacterial two-hybrid system: Fuse SACOL0202 domains to T18/T25 fragments of adenylate cyclase and screen against an S. aureus genomic library

    • Pull-down with mass spectrometry: Express epitope-tagged SACOL0202 in S. aureus, perform immunoprecipitation, and identify co-precipitating proteins by LC-MS/MS

    • Proximity-dependent biotin labeling: Fuse SACOL0202 to BioID or TurboID and identify biotinylated proximal proteins

    • FRET/BRET assays: For validating specific interactions with candidate partners

  • In vitro approaches:

    • Surface plasmon resonance (SPR): Immobilize purified SACOL0202 and measure binding affinities with potential partners

    • Isothermal titration calorimetry (ITC): Determine binding thermodynamics of SACOL0202 interactions

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): Characterize complex formation and stoichiometry

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Map interaction interfaces

  • Domain-specific interaction mapping:

    • Separately test interactions of sensor, HAMP, DHp, and CA domains

    • Create chimeric proteins to identify domain-specific interactions

    • Use peptide arrays to map specific binding motifs

  • Bioinformatic prediction:

    • Employ coevolution analysis to predict interaction partners

    • Use structural modeling to predict protein-protein docking

    • Compare with known interactomes of homologous proteins in related species

  • Validation in physiological context:

    • Gene knockouts of identified partners to assess functional relevance

    • Phosphotransfer assays with identified partners

    • Mutagenesis of predicted interaction interfaces

How might SACOL0202 be targeted for antimicrobial development?

Given the importance of two-component systems in bacterial virulence and the lack of homologs in humans, SACOL0202 represents a potential target for novel antimicrobial development:

  • Structure-based drug design approaches:

    • Target the ATP-binding pocket of the CA domain with competitive inhibitors

    • Design molecules that disrupt the interaction between SACOL0202 and SACOL0201

    • Develop allosteric inhibitors that lock the protein in an inactive conformation

  • High-throughput screening strategies:

    • Develop fluorescence-based assays for monitoring SACOL0202 autophosphorylation

    • Screen chemical libraries for inhibitors of kinase activity

    • Use bacterial reporter systems expressing fluorescent proteins under control of SACOL0201-regulated promoters

  • Peptide-based inhibitors:

    • Design peptides mimicking the DHp-CA interface to disrupt intramolecular interactions

    • Develop peptides that compete with SACOL0201 for binding to phosphorylated SACOL0202

  • Alternative approaches:

    • RNA-based therapeutics targeting SACOL0202 mRNA

    • CRISPR-Cas systems targeting the SACOL0202 gene

    • Bacteriophage endolysins as adjunctive therapy with conventional antibiotics

  • Validation and development path:

    • In vitro enzyme inhibition assays

    • Cell-based activity assays in S. aureus

    • Efficacy testing in animal infection models

    • Toxicity and pharmacokinetic evaluation

The increasing antibiotic resistance profile of S. aureus underscores the need for novel therapeutic approaches . Targeting virulence regulation through two-component systems like SACOL0202/SACOL0201 could provide alternatives to conventional antibiotics that exert less selective pressure for resistance.

How does SACOL0202 compare with other histidine kinases in terms of evolutionary conservation and functional specialization?

Evolutionary analysis of SACOL0202 can provide insights into its specialization and importance:

  • Phylogenetic analysis:

    • Compare SACOL0202 sequences across Staphylococcus species and related genera

    • Identify conserved vs. variable regions that might reflect functional specialization

    • Construct phylogenetic trees to determine evolutionary relationships with other histidine kinases

  • Domain architecture analysis:

    • Compare the domain organization of SACOL0202 with other histidine kinases

    • Identify unique features that might contribute to its specific function

    • Analyze the co-evolution of SACOL0202 with its cognate response regulator SACOL0201

  • Selective pressure analysis:

    • Calculate dN/dS ratios to identify regions under purifying or diversifying selection

    • Compare conservation patterns between pathogenic and non-pathogenic Staphylococci

    • Identify potential host-pathogen interaction signatures

  • Comparative genomics:

    • Analyze the genomic context of SACOL0202 across different bacterial species

    • Identify co-occurring genes that might provide functional insights

    • Compare with other two-component systems involved in virulence regulation

FeatureSACOL0202Other HKs in S. aureusHKs in Other Bacteria
Domain ArchitectureSensor-HAMP-DHp-CAVariable sensor domainsGreater diversity in non-pathogens
Genomic ContextTwo-component operonVarious arrangementsOften linked to regulated genes
Selection Pressure[To be determined]Higher conservation in core systemsVariable based on environmental niche
Specificity Determinants[To be determined]Variable DHp residuesDiverse recognition mechanisms

Understanding the evolutionary context of SACOL0202 could inform both its fundamental biological role and its potential as an antimicrobial target with species specificity.

What are the common technical challenges in expressing and purifying functional SACOL0202, and how can they be addressed?

Researchers often encounter several challenges when working with histidine kinases like SACOL0202:

  • Low expression yields:

    • Solution: Optimize codon usage for E. coli expression; try different promoters (T7, tac, araBAD); test expression in specialized strains (C41/C43 for membrane proteins)

    • Alternative approach: Use cell-free expression systems which often perform better with membrane proteins

  • Protein insolubility:

    • Solution: Express at lower temperatures (16-20°C); use solubility-enhancing tags (MBP, SUMO); optimize buffer conditions (add glycerol, mild detergents)

    • Alternative approach: Express only the cytoplasmic portion (similar to HK853-CD)

  • Inactive protein:

    • Solution: Include stabilizing ligands during purification; purify in the presence of ATP/Mg²⁺; avoid freeze-thaw cycles

    • Validation method: Verify activity using in vitro phosphorylation assays with [γ-32P]ATP

  • Oligomerization issues:

    • Solution: Add reducing agents (DTT or TCEP) to prevent disulfide-mediated aggregation; optimize ionic strength

    • Analytical approach: Verify dimeric state using SEC-MALS or analytical ultracentrifugation

  • Degradation during purification:

    • Solution: Include protease inhibitors; perform purification at 4°C; minimize time between purification steps

    • Quality control: Assess protein integrity by mass spectrometry and SDS-PAGE

ChallengeDiagnostic SignsPotential SolutionsValidation Methods
InsolubilityProtein in pellet after lysisLower temperature, detergents, fusion tagsWestern blot of soluble fraction
MisfoldingNo activity, abnormal SEC profileRefolding protocols, chaperone co-expressionCircular dichroism, activity assays
AggregationHigh MW bands on native PAGEOptimize buffer ionic strengthDynamic light scattering
ProteolysisMultiple bands on SDS-PAGEProtease inhibitors, C-terminal His-tagMass spectrometry

How can contradictory results in SACOL0202 functional studies be resolved methodologically?

When facing contradictory results in SACOL0202 studies, a systematic troubleshooting approach is essential:

  • Strain and genetic background variations:

    • Problem: Different S. aureus strains might show variable dependence on SACOL0202

    • Solution: Use isogenic mutants; test multiple reference strains; fully sequence strains to identify potential compensatory mutations

  • Experimental condition inconsistencies:

    • Problem: SACOL0202 activity may be condition-dependent

    • Solution: Standardize growth conditions (media, temperature, pH, oxygen); compare results across a matrix of conditions; include positive and negative controls

  • Technical variability in assays:

    • Problem: Different assay methods can yield conflicting results

    • Solution: Validate findings using multiple independent techniques; include internal controls; blind sample analysis

  • Protein modification status:

    • Problem: Post-translational modifications may affect activity

    • Solution: Characterize phosphorylation state; verify protein integrity by mass spectrometry; assess effects of potential modifying enzymes

  • Data interpretation differences:

    • Problem: Statistical analysis or thresholds for significance may vary

    • Solution: Apply consistent statistical methods; define clear thresholds; perform meta-analysis of multiple datasets when available

A structured approach to addressing conflicting results should include:

  • Replication in independent laboratories

  • Sharing of reagents, strains, and detailed protocols

  • Pre-registration of experimental designs when possible

  • Integration of multiple data types (genetic, biochemical, structural)

Systematic validation of critical findings using complementary methodologies remains the gold standard for resolving contradictions in the scientific literature.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.