Recombinant Staphylococcus aureus Uncharacterized sensor-like histidine kinase SAOUHSC_00185 (SAOUHSC_00185)

Shipped with Ice Packs
In Stock

Description

Introduction

Histidine kinases (HKs) are a class of enzymes (EC 2.7.13.3) that catalyze the transfer of a phosphate group from ATP to a histidine residue in a protein . In bacteria, HKs are often part of two-component systems (TCSs) that enable the bacteria to sense and respond to changes in their environment . These systems typically consist of a HK and a response regulator (RR) . The HK senses a specific signal and, in response, autophosphorylates a histidine residue . The phosphate group is then transferred to an aspartate residue on the RR, which in turn regulates the expression of target genes .

Staphylococcus aureus is a Gram-positive bacterium that can cause a variety of infections in humans . It utilizes TCSs to regulate various processes, including metabolism, virulence, and homeostasis . SAOUHSC_00185 is an uncharacterized sensor-like histidine kinase in S. aureus for which the specific function and signaling pathways have not been fully elucidated .

Structure and Function of Histidine Kinases

An HK typically consists of several domains:

  • A short N-terminal cytoplasmic region.

  • An extracellular sensing domain connected via a transmembrane α helix.

  • A second transmembrane α helix connecting the extracellular domain to the C-terminal cytoplasmic catalytic domain .

The cytoplasmic domain contains conserved motifs, including the H, N, G1, F, and G2 boxes . The H-box, located in the N-terminal dimerization and histidine phosphotransfer (DHp) domain, contains the histidine residue that undergoes autophosphorylation . The N, G1, F, and G2 boxes are located in the C-terminal catalytic and ATP-binding (CA) domain .

HWE/HisKA2 Kinases

HWE/HisKA2 kinases are a subset of HKs defined by unique sequence motifs in both the catalytic and non-catalytic regions . They often do not signal via classical DNA-binding response regulators, but instead, are part of atypical regulatory pathways that control changes in gene expression via modulation of protein-protein interactions or transcription anti-termination . Two key features distinguish HWE-family kinases from typical HisKA kinases:

  1. A unique set of residues that surround the phosphoryl-accepting histidine (H-box).

  2. A conserved arginine present in the second helix that is not found in other histidine kinases (R-box) .

WalRK System in Staphylococcus aureus

The WalRK system is an essential TCS in S. aureus involved in modulation of staphylococcal autolytic activity and controls cell wall metabolism . It consists of the histidine kinase WalK and the response regulator WalR . Studies have shown that WalR and WalK might differently control bacterial lysis in the RN4220 strain . Down-regulation of walR expression effectively inhibited Triton X-100-induced lysis and had a weak impact on bacterial tolerance to penicillin-induced cell lysis, while down-regulation of walK expression had no influence on either Triton X-100- or penicillin-caused autolysis .

Histidine Kinases as Antimicrobial Targets

Histidine kinases are essential for bacterial survival and virulence, making them attractive targets for developing novel antimicrobial agents . Waldiomycin, for example, inhibits HKs by binding to the H-box region of the DHp domain . Molecular docking studies and molecular dynamics simulations have indicated that the amino acid residue Lys100 is a key residue for hydrogen bonding with waldiomycin at the binding site and possibly important for the enzyme activity .

VraS Histidine Kinase

VraS, a membrane histidine kinase in S. aureus, acts as a direct receptor for vancomycin and ampicillin, two structurally distinct antibiotics . It plays a crucial role in fighting off cell-wall-active antibiotics like vancomycin and ampicillin . Identifying VraS as a direct antibiotic receptor provides a promising target for developing inhibitors to disrupt VraTSR signaling and restore antibiotic efficacy .

AgrC Histidine Kinase

AgrC is an integral membrane protein and a histidine kinase whose sensor domains interact with an autoinducing peptide, resulting in a series of downstream events . AgrC and AgrA constitute a two-component system with AgrC as the sensor histidine kinase and AgrA as the response regulator .

SAOUHSC_00185

SAOUHSC_00185 is an uncharacterized sensor-like histidine kinase in S. aureus. An ELISA kit is available for the detection of SAOUHSC_00185 . Further research is needed to elucidate the specific function, signaling pathways, and potential role of SAOUHSC_00185 in S. aureus.

Future Directions

Further research is required to fully understand the function of SAOUHSC_00185. Potential research areas could include:

  • Identifying the specific signal(s) that activate SAOUHSC_00185.

  • Determining the downstream targets of SAOUHSC_00185.

  • Investigating the role of SAOUHSC_00185 in S. aureus virulence and pathogenesis.

  • Exploring the potential of SAOUHSC_00185 as a target for novel antimicrobial agents.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
hptS; SAOUHSC_00185; Sensor protein kinase HptS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-518
Protein Length
full length protein
Species
Staphylococcus aureus (strain NCTC 8325)
Target Names
SAOUHSC_00185
Target Protein Sequence
MTAYKPYRHQLRRSLFASTIFPVFLVIIIGLVSFYAIYIWIEHRTIHQHVDESQSSLHHT EKQIQTFITQHNNSFQELDLTNHHDVTATKRELLKLIHQQPATLYYELSGPNQFITNNYE HLNTKNMYLFSTHQLKFKNSTYMLKIYMANTPRLSEIKKDNRQFALIVDQYDNILYANDD RFTIGEKYRPQQFGFMNESVKLNHADHRLIIYKDIHENIEDGITLLIVMAVVLVLLVIFG FISADNMAKRQTKDIETIIQKIYYAKNRHLGTYTPLKNNSELEEINNYIYDLFESNEQLI HSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQYLITLSPKLAQTVVQQLSQMLRYSL RTNSHTVELNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMMLQPLIENAIK HGRDTESLDITIRLTLARQNLHVLVCDNGIGMSSSRLQYVRQSLNNDVFDTKHLGLNHLH NKAMIQYGSHARLHIFSKRNQGTLICYKIPLSRGNVDV
Uniprot No.

Target Background

Function
SAOUHSC_00185, a member of the two-component regulatory system HptS/HptR in *Staphylococcus aureus*, regulates genes involved in hexose phosphate transport in response to extracellular phosphate levels. It functions as a sensor protein kinase, autophosphorylating at a histidine residue before transferring the phosphate to a conserved aspartic acid residue in HptS. HptS, in turn, counteracts CcpA-dependent transcription of genes involved in antibiotic susceptibility.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SAOUHSC_00185 and how does it function in S. aureus?

SAOUHSC_00185 is an uncharacterized sensor-like histidine kinase in Staphylococcus aureus that likely functions as part of a two-component signal transduction system (TCS). In typical bacterial TCS, histidine kinase receptors serve as crucial elements for environmental adaptation by coupling extracellular changes to intracellular responses. These systems typically consist of a membrane-spanning histidine kinase sensor and a cytoplasmic response regulator. When extracellular signals are detected by the periplasmic sensor domain, the catalytic activity of the cytoplasmic histidine kinase domain is modulated, promoting ATP-dependent autophosphorylation of a conserved histidine residue. This phosphate is subsequently transferred to a conserved aspartate residue on the cognate response regulator through a phosphotransfer mechanism, which then modulates downstream activity . While the specific function of SAOUHSC_00185 remains to be fully characterized, it likely plays a role in S. aureus environmental adaptation and potentially in virulence regulation.

How is the structure of SAOUHSC_00185 likely organized?

Based on our understanding of histidine kinases, SAOUHSC_00185 likely possesses a modular structure consisting of several domains:

  • A periplasmic sensor domain that detects environmental signals

  • Transmembrane regions that anchor the protein in the cell membrane

  • A conserved cytoplasmic catalytic domain containing the histidine phosphorylation site

  • Potential dimerization and phosphotransfer domains

A prototypical sensor histidine kinase contains a long extracellular sensory domain that directly senses external stimuli . The histidine kinase catalytic domain and other cytoplasmic elements are generally conserved across different kinases, whereas the sensor domains are highly variable in sequence, reflecting their diverse roles in sensing different environmental signals . This structural organization allows for the specific detection of signals and transmission of information across the cell membrane.

What techniques are available to investigate SAOUHSC_00185 expression patterns?

Several methodological approaches can be employed to investigate SAOUHSC_00185 expression patterns:

Quantitative PCR (qPCR): This technique can measure transcription levels of SAOUHSC_00185 under different environmental conditions or growth phases. Similar to studies on other S. aureus TCS, where transcription of sensor kinases such as arlS, hptS, and lytS was measured to determine the effect of cardiolipin on their expression , qPCR can be employed to quantify SAOUHSC_00185 mRNA levels.

RNA-Seq: This approach provides a comprehensive transcriptomic analysis that can reveal not only SAOUHSC_00185 expression but also its relationship with other genes in relevant regulatory networks.

Western Blotting: Using antibodies specific to SAOUHSC_00185, protein expression levels can be quantified. This technique is similar to that employed for detecting cell wall-bound proteins in S. aureus, where membranes were incubated with polyclonal antibodies and visualized using IRDye-labeled secondary antibodies .

Reporter Gene Constructs: Fusing the SAOUHSC_00185 promoter to reporter genes like GFP or luciferase can allow real-time monitoring of expression in response to different stimuli.

What approaches can identify the cognate response regulator of SAOUHSC_00185?

Identifying the cognate response regulator paired with SAOUHSC_00185 requires systematic investigation:

Genomic Context Analysis: Often, histidine kinases and their cognate response regulators are encoded in the same operon. Bioinformatic analysis of the genomic region surrounding SAOUHSC_00185 may reveal its paired response regulator.

Phosphotransfer Profiling: In vitro phosphotransfer assays using purified SAOUHSC_00185 and candidate response regulators can identify specific phosphotransfer interactions. This approach has been used to characterize phosphotransfer from sensor histidine kinases to response regulators in many bacterial systems .

Bacterial Two-Hybrid Assays: These assays can detect protein-protein interactions between SAOUHSC_00185 and potential response regulators.

Knockout/Complementation Studies: Creating deletion mutants of SAOUHSC_00185 and potential response regulators, followed by phenotypic analysis and complementation studies, can help identify functionally linked pairs.

How might membrane phospholipids like cardiolipin affect SAOUHSC_00185 activity?

Membrane phospholipids, particularly cardiolipin (CL), may significantly influence SAOUHSC_00185 activity through several mechanisms:

Direct Binding and Conformational Changes: Cardiolipin can directly bind to sensor histidine kinases and modulate their kinase activity. Research on other S. aureus sensor kinases has demonstrated that purified sensor proteins can directly bind to cardiolipin and phosphatidylglycerol . For instance, the S. aureus sensor kinase SaeS shows decreased kinase activity when cardiolipin is eliminated from the membranes . SAOUHSC_00185 may similarly interact with membrane phospholipids, affecting its conformation and kinase activity.

Membrane Microdomain Formation: Cardiolipin can create specialized membrane microdomains that may recruit and organize sensor kinases like SAOUHSC_00185, facilitating their interaction with other signaling components.

Research approaches to investigate these interactions include:

  • Lipid binding assays with purified SAOUHSC_00185 protein

  • Reconstitution of SAOUHSC_00185 in liposomes with varied lipid compositions

  • Activity assays in the presence of different phospholipids

  • Structural studies of SAOUHSC_00185-lipid complexes

PhospholipidEffect on TCS ActivityPotential Mechanism
CardiolipinEnhanced kinase activityDirect binding and conformational change
PhosphatidylglycerolModerate enhancementDirect binding
PhosphatidylethanolamineVariable effectsMembrane fluidity alteration
Lysyl-phosphatidylglycerolPotential inhibitionCharge-based interactions

What experimental approaches can establish SAOUHSC_00185's role in S. aureus virulence?

Investigating SAOUHSC_00185's role in S. aureus virulence requires a multi-faceted approach:

Gene Deletion Studies: Creating SAOUHSC_00185 knockout mutants can reveal its contribution to virulence. Similar studies with other TCS genes have shown that strains lacking cls2 or cls1cls2 (involved in cardiolipin synthesis that affects TCS function) render S. aureus less cytotoxic to human neutrophils and less virulent in mouse infection models .

Complementation Assays: Reintroducing SAOUHSC_00185 into knockout strains can confirm phenotypic changes are specifically due to this gene.

Virulence Factor Expression Analysis: Measuring expression of known virulence factors in wild-type versus SAOUHSC_00185 mutants can identify regulated genes. This could include assessments of:

  • Secreted toxins and enzymes

  • Adhesion proteins

  • Immune evasion factors

  • Biofilm formation capacity

Animal Infection Models: Testing SAOUHSC_00185 mutants in various infection models (e.g., skin and soft tissue infection, bacteremia, endocarditis) can reveal tissue-specific roles in pathogenesis.

Host Cell Interaction Studies: Investigating how SAOUHSC_00185 affects S. aureus interactions with host cells:

  • Adhesion to and invasion of epithelial cells

  • Survival within professional phagocytes

  • Cytotoxicity toward human neutrophils, similar to studies showing that cardiolipin-deficient strains (affecting TCS function) were less cytotoxic to neutrophils

How can phosphorylation dynamics of SAOUHSC_00185 be effectively studied?

Studying the phosphorylation dynamics of SAOUHSC_00185 requires specialized techniques:

In vitro Phosphorylation Assays: Purified SAOUHSC_00185 can be incubated with radiolabeled ATP (γ-32P-ATP) to monitor autophosphorylation rates. Similar approaches have been used to study other histidine kinases that undergo ATP-dependent autophosphorylation of conserved histidine residues .

Phosphotransfer Kinetics: Time-course experiments can measure the rate of phosphate transfer from SAOUHSC_00185 to its cognate response regulator.

Pulse-Chase Experiments: These can determine the stability of the phosphorylated state of SAOUHSC_00185 under different conditions.

Mass Spectrometry Approaches:

  • Selected reaction monitoring (SRM) to quantify phosphorylated peptides

  • Phosphoproteomic analysis to identify phosphorylation sites

  • Hydrogen-deuterium exchange mass spectrometry to detect conformational changes upon phosphorylation

Phosphomimetic Mutations: Creating mutations that mimic phosphorylated (Asp) or non-phosphorylated (Ala) states of the conserved histidine can help understand the functional consequences of phosphorylation.

What structural determinants influence SAOUHSC_00185 signal sensing specificity?

Understanding the structural determinants of SAOUHSC_00185 signal sensing requires detailed structural analysis:

Domain Swapping Experiments: Exchanging sensor domains between SAOUHSC_00185 and other histidine kinases can help identify regions responsible for signal specificity.

Site-Directed Mutagenesis: Systematic mutation of residues in the sensor domain can identify those critical for signal detection. This approach has been valuable in understanding how prototypical sensor histidine kinases detect external stimuli through their extracellular sensory domains .

Structural Biology Approaches:

  • X-ray crystallography of the sensor domain (similar to the structural genomics project mentioned for the HK29s domain )

  • Cryo-electron microscopy for full-length protein structure

  • NMR studies for dynamic structural changes upon ligand binding

  • Molecular dynamics simulations to predict conformational changes

Comparative Sequence Analysis: Alignment of SAOUHSC_00185 with characterized histidine kinases can identify conserved motifs involved in sensing specific signals.

What expression systems are optimal for recombinant SAOUHSC_00185 production?

Producing recombinant SAOUHSC_00185 presents challenges due to its membrane-associated nature. Several expression systems can be considered:

E. coli Expression Systems:

  • BL21(DE3) with pET Vectors: A standard system that can be optimized with reduced temperature (16-20°C) and low IPTG concentrations to minimize inclusion body formation.

  • C41(DE3) and C43(DE3): Strains specifically designed for membrane protein expression.

  • Fusion Tags: MBP, SUMO, or TrxA tags can enhance solubility, similar to the MBP-His6 control protein used in some studies .

Cell-Free Expression Systems: These can be supplemented with detergents or lipids to facilitate proper folding of membrane proteins.

Methological considerations:

  • Express only the cytoplasmic portion for kinase activity studies

  • Use specialized growth media with osmolytes for membrane protein stability

  • Optimize induction conditions (temperature, inducer concentration, duration)

  • Consider co-expression with molecular chaperones

Expression SystemAdvantagesDisadvantagesRecommended Application
E. coli BL21(DE3)High yield, economicalInclusion body riskCytoplasmic domains
E. coli C41/C43Better for membrane proteinsLower yieldFull-length protein
Cell-free systemRapid, customizable environmentExpensive, limited scaleInitial screening
Bacillus subtilisCloser to native environmentMore complex geneticsNative-like studies
S. aureusMost natural environmentLimited tools, pathogenicFinal validation

What methods can effectively assess SAOUHSC_00185 kinase activity?

Several complementary methods can assess the kinase activity of SAOUHSC_00185:

Radiometric Assays:

  • Incubate purified SAOUHSC_00185 with [γ-32P]ATP

  • Separate proteins by SDS-PAGE

  • Detect phosphorylated protein by autoradiography

  • Quantify radioactive incorporation

This approach parallels studies of other histidine kinases where ATP-dependent autophosphorylation of conserved histidine residues is a key activity measure .

Fluorescence-Based Assays:

  • Use fluorescently-labeled ATP analogs

  • Monitor changes in fluorescence during ATP consumption

  • Real-time kinetic measurements possible

ADP Production Assays:

  • Couple ADP production to NADH oxidation

  • Monitor NADH consumption spectrophotometrically

  • Calculate enzyme activity based on NADH reduction

Phosphotransfer Assays:

  • Incubate phosphorylated SAOUHSC_00185 with purified response regulator

  • Monitor phosphate transfer using radiolabeled ATP or Phos-tag™ SDS-PAGE

  • Quantify response regulator phosphorylation

In vivo Reporter Systems:

  • Create reporter constructs where response regulator activity drives reporter gene expression

  • Measure reporter output (fluorescence, luminescence)

  • Infer SAOUHSC_00185 activity from response regulator activation

How can researchers identify environmental signals sensed by SAOUHSC_00185?

Identifying the environmental signals detected by SAOUHSC_00185 requires systematic screening approaches:

Transcriptional Reporter Assays:

  • Fuse promoters of genes regulated by SAOUHSC_00185's cognate response regulator to reporter genes (GFP, luciferase)

  • Screen diverse environmental conditions (pH, temperature, osmolarity, nutrients, antimicrobials)

  • Identify conditions that alter reporter expression

Phenotypic Microarrays:

  • Compare wild-type and ΔSAOUHSC_00185 strains across hundreds of growth conditions

  • Identify conditions where the mutant shows altered growth phenotypes

Metabolite Screening:

  • Test purified SAOUHSC_00185 sensor domain binding to metabolite libraries

  • Use differential scanning fluorimetry to detect thermal stability shifts upon ligand binding

  • Confirm binding with isothermal titration calorimetry or surface plasmon resonance

In silico Approaches:

  • Structural modeling of the sensor domain

  • Virtual screening of potential ligands

  • Molecular docking simulations to predict binding affinities

Transposon Mutagenesis:

  • Create a transposon library in wild-type and ΔSAOUHSC_00185 backgrounds

  • Screen for mutations that phenocopy or suppress SAOUHSC_00185 phenotypes

  • Identify metabolic pathways connected to SAOUHSC_00185 signaling

What molecular typing methods are most informative for studying S. aureus strains expressing SAOUHSC_00185 variants?

Several molecular typing methods can characterize S. aureus strains with different SAOUHSC_00185 variants:

Multi-Locus Variable-Number Tandem Repeat Fingerprinting (MLVF):
MLVF typing involves multiplex PCR amplification of several variable number tandem repeats (VNTRs) in S. aureus, including sdrC, sdrD, sdrE, clfA, clfB, sspA, and spa. The resulting amplicons can be separated using a Bioanalyzer with microfluidic DNA chips, similar to the approach described in the search results . This method provides high discriminatory power for differentiating S. aureus strains.

Spa-Typing:
This technique involves sequencing the polymorphic X region of the S. aureus protein A gene (spa) and analyzing the specific repeats present, as described in the search results . Different spa types (e.g., t2953, t3196, t416, t114) can be identified and correlated with SAOUHSC_00185 variants.

Whole Genome Sequencing:
This provides the most comprehensive information, allowing identification of single nucleotide polymorphisms (SNPs) and structural variations in SAOUHSC_00185 and associated genes.

PCR-RFLP Analysis:

  • Amplify SAOUHSC_00185 by PCR

  • Digest with restriction enzymes

  • Analyze fragment patterns to identify variants

MLST (Multi-Locus Sequence Typing):
Sequence specific housekeeping genes to assign sequence types that may correlate with SAOUHSC_00185 variants.

How should researchers interpret conflicting data regarding SAOUHSC_00185 function?

When faced with conflicting data about SAOUHSC_00185 function, researchers should employ a systematic approach:

Context-Dependent Effects Analysis:
Histidine kinase function can be highly context-dependent, varying with growth phase, environmental conditions, and genetic background. For example, research on the S. aureus Sae system showed that human neutrophil peptides (HNPs) induce Sae in the stationary growth phase, but different mechanisms operate in the exponential growth phase . Therefore:

  • Carefully document all experimental conditions

  • Test SAOUHSC_00185 function across multiple growth phases

  • Examine strain-specific differences

  • Consider environmental variation in signal concentrations

Technical Validation:

  • Use multiple complementary techniques to assess the same function

  • Verify antibody specificity with appropriate controls

  • Include wild-type, knockout, and complemented strains in all experiments

  • Use both gain-of-function and loss-of-function approaches

Statistical Rigor:

  • Perform adequate biological and technical replicates

  • Use appropriate statistical tests for data analysis

  • Consider effect sizes, not just statistical significance

  • Address outliers systematically

Integration with Systems Biology:

  • Examine SAOUHSC_00185 in the context of the entire TCS network

  • Consider crosstalk between different signaling systems

  • Use mathematical modeling to test hypothesized mechanisms

  • Integrate transcriptomic, proteomic, and metabolomic data

What bioinformatic approaches can predict SAOUHSC_00185 interaction networks?

Predicting SAOUHSC_00185 interaction networks requires sophisticated bioinformatic approaches:

Sequence-Based Methods:

  • Domain Architecture Analysis: Identify interaction domains in SAOUHSC_00185 that may mediate protein-protein interactions

  • Genomic Context Analysis: Examine gene neighborhood conservation across species

  • Phylogenetic Profiling: Identify genes with similar evolutionary patterns

Structural Bioinformatics:

  • Molecular Docking: Predict binding between SAOUHSC_00185 and potential interaction partners

  • Molecular Dynamics Simulations: Model dynamic interactions in a membrane environment

  • Homology Modeling: Build structural models based on related histidine kinases

Network Analysis:

  • Guilt-by-Association: Predict functions based on known interaction partners

  • Co-expression Analysis: Identify genes with similar expression patterns across conditions

  • Text Mining: Extract potential interactions from scientific literature

Machine Learning Approaches:

  • Develop supervised learning models trained on known TCS interaction networks

  • Use feature selection to identify key sequence or structural determinants of specificity

  • Apply ensemble methods to improve prediction accuracy

Prediction MethodData RequiredOutputValidation Approach
Gene neighborhood analysisGenome sequencesPotential operons and functional associationsPCR of intergenic regions
Co-expression analysisTranscriptomic data across conditionsGenes with similar expression patternsRT-qPCR validation
Structural modelingProtein sequences, template structuresPredicted 3D structures and interaction interfacesMutagenesis of predicted interface residues
Bacterial two-hybrid predictionsProtein sequencesPredicted binary interactionsExperimental B2H validation

How can researchers accurately assess the impact of SAOUHSC_00185 mutations on S. aureus virulence?

Accurately assessing the impact of SAOUHSC_00185 mutations on S. aureus virulence requires a multi-faceted approach:

Isogenic Strain Construction:

  • Generate clean deletion mutants using allelic replacement

  • Create complemented strains with wild-type SAOUHSC_00185

  • Engineer strains with specific point mutations in key domains

  • Verify mutants using whole genome sequencing to confirm no off-target effects

In vitro Virulence Assays:

  • Toxin Production: Quantify hemolysins, leukocidins, and other toxins

  • Enzyme Activity: Measure proteases, lipases, and other virulence-associated enzymes

  • Biofilm Formation: Assess attachment and biofilm development capacity

  • Immune Evasion: Test resistance to antimicrobial peptides and phagocytosis

Ex vivo Models:

  • Whole Blood Survival: Measure bacterial survival in human blood

  • Neutrophil Killing Assays: Similar to studies showing cardiolipin-dependent effects on S. aureus cytotoxicity to neutrophils

  • Tissue Explant Models: Test infection of human tissue explants

In vivo Infection Models:

  • Systemic Infection: Monitor bacterial burden in organs and survival rates

  • Localized Infection: Assess abscess formation and tissue damage

  • Specialized Models: Test endocarditis, osteomyelitis, or pneumonia as relevant

Multi-Omics Integration:

  • Transcriptomics to identify virulence genes regulated by SAOUHSC_00185

  • Proteomics to confirm changes at protein level

  • Metabolomics to detect alterations in virulence-associated metabolites

  • Systems biology modeling to integrate datasets

What controls are essential when studying lipid-SAOUHSC_00185 interactions?

Studying lipid-SAOUHSC_00185 interactions requires rigorous controls to ensure reliable results:

Protein Purity Controls:

  • Multiple Purification Steps: Size exclusion chromatography following affinity purification

  • SDS-PAGE and Western Blot: Confirm purity and identity of SAOUHSC_00185

  • Mass Spectrometry: Verify protein integrity and detect potential modifications

  • Control Proteins: Include non-binding proteins (e.g., MBP-His6 as used in studies showing it did not bind to lipids tested )

Lipid Preparation Controls:

  • Lipid Purity: Verify using thin-layer chromatography

  • Defined Composition: Use synthetic lipids with known structures

  • Physical State Verification: Ensure proper formation of liposomes or bilayers

  • Multiple Preparation Methods: Compare results with different lipid presentation formats

Binding Specificity Controls:

  • Structurally Unrelated Lipids: Test binding to diverse lipid classes

  • Concentration Gradients: Perform dose-response experiments

  • Competition Assays: Determine relative binding affinities

  • Mutant Proteins: Test binding with altered putative lipid-binding sites

Functional Validation:

  • Activity Correlation: Measure SAOUHSC_00185 kinase activity in the presence of lipids

  • In vivo Relevance: Test mutants with altered lipid-binding in cellular models

  • Membrane Mimetics: Compare results in different membrane-mimicking systems

  • Environmental Variables: Test effects of pH, temperature, and ionic strength

What emerging technologies might advance SAOUHSC_00185 research?

Several cutting-edge technologies hold promise for advancing SAOUHSC_00185 research:

Cryo-Electron Microscopy:
The revolution in cryo-EM technology enables structural determination of membrane proteins like SAOUHSC_00185 in near-native states. This technique could reveal:

  • Full-length structures including transmembrane regions

  • Conformational changes upon signal binding

  • Oligomeric arrangements in the membrane

  • Complex formation with response regulators

Single-Molecule Techniques:

  • FRET Studies: Monitor conformational changes in real-time

  • Single-Particle Tracking: Observe SAOUHSC_00185 dynamics in live cells

  • Force Spectroscopy: Measure mechanical properties during signal transduction

Genome Editing Technologies:

  • CRISPR-Cas9 Systems: Create precise mutations in SAOUHSC_00185

  • Base Editors: Introduce specific amino acid changes without double-strand breaks

  • CRISPRi/CRISPRa: Modulate SAOUHSC_00185 expression without genetic modification

Advanced Imaging:

  • Super-Resolution Microscopy: Visualize SAOUHSC_00185 localization in bacterial membranes

  • Expansion Microscopy: Physically enlarge bacteria to observe protein organization

  • Correlative Light and Electron Microscopy: Connect functional and structural observations

Microfluidic Systems:

  • Single-Cell Analysis: Examine cell-to-cell variation in SAOUHSC_00185 activity

  • Gradient Generators: Test responses to precisely controlled signal concentrations

  • Bacterial Navigation Chambers: Observe chemotactic responses mediated by SAOUHSC_00185

How can computational modeling enhance understanding of SAOUHSC_00185 function?

Computational modeling offers powerful approaches to understand SAOUHSC_00185 function:

Molecular Dynamics Simulations:

  • Model SAOUHSC_00185 in realistic membrane environments

  • Simulate conformational changes upon signal binding

  • Investigate lipid-protein interactions at atomic resolution

  • Predict effects of mutations on protein stability and function

Network Modeling:

  • Integrate SAOUHSC_00185 into S. aureus regulatory networks

  • Simulate system-wide effects of SAOUHSC_00185 activation/deactivation

  • Identify potential feedback loops and crosstalk with other signaling systems

  • Predict emergent properties of the network

Machine Learning Applications:

  • Predict ligands using binding site characteristics

  • Identify functional motifs through sequence analysis

  • Classify SAOUHSC_00185 variants based on phenotypic data

  • Optimize experimental design for maximum information gain

Quantitative Systems Pharmacology:

  • Model drug interactions with SAOUHSC_00185

  • Predict system-wide effects of histidine kinase inhibition

  • Simulate resistance development pathways

  • Design combination therapies targeting multiple TCS components

Evolutionary Simulations:

  • Reconstruct the evolutionary history of SAOUHSC_00185

  • Identify selective pressures on different protein domains

  • Predict functionally important residues conserved across species

  • Model co-evolution with response regulators and signaling targets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.