Recombinant Staphylococcus aureus Uncharacterized sensor-like histidine kinase SAS0199 (SAS0199)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us for preferential development.
Synonyms
hptS; SAS0199; Sensor protein kinase HptS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-518
Protein Length
full length protein
Species
Staphylococcus aureus (strain MSSA476)
Target Names
SAS0199
Target Protein Sequence
MTAYKPYRHQLRRSLFASTIFPVFLVIIIGLVSFYAIYIWIEHRTIHQHVDESQSSLHHT EKQIQTFITQHNNSFQELDLTNHHDVTATKRGLLKLIHQQPATLYYELSGPNQFITNNYE HLNTKNMYLFSTHQLKFKNSTYMLKIYMANTPRLSEIKKDSRQFALIVDQYDNILYANDD RFTIGEKYRPQQFGFMNESVKLNHADHRLIIYKDIHENIEDGITLLIVMAVVLVLLVIFG FISADNMAKRQTKDIETIIQKIYYAKNRHLGTYTPLKNNSELEEINNYIYDLFESNEQLI HSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQYLITLSPKLAQTVVQQLSQMLRYSL RTNSHTVELNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMMLQPLIENAIK HGRDTESLDITIRLTLARQNLHVLVCDNGIGMSSSRLQYVRQSLNNDVFDTKHLGLNHLH NKAMIQYGSHARLHIFSKRNQGTLICYKIPLSRGNVDV
Uniprot No.

Target Background

Function
SAS0199 is a member of the two-component regulatory system HptS/HptR in *Staphylococcus aureus*. This system regulates genes involved in hexose phosphate transport, responding to extracellular phosphate levels. SAS0199 likely functions as a sensor kinase, autophosphorylating at a histidine residue before transferring the phosphate to an aspartic acid residue in the HptS regulatory domain. HptS subsequently antagonizes CcpA-dependent transcription of genes affecting antibiotic susceptibility.
Database Links

KEGG: sas:SAS0199

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SAS0199 and what structural domains might it contain?

SAS0199 is an uncharacterized sensor-like histidine kinase in Staphylococcus aureus. Based on comparative analysis with other sensor histidine kinases like VicK from Streptococcus mutans, it likely contains several conserved domains:

  • A transmembrane domain

  • A HAMP domain (signal transducer)

  • A PAS domain (major sensor)

  • A DHp domain (dimerization and histidine phosphorylation)

  • A CA domain (catalytic and ATP binding)

These domains typically function in a sequential manner to relay environmental signals through phosphorylation cascades. The HAMP domain likely adopts a knobs-to-knobs interhelical structure that mediates transmembrane signal transmission through coordinated helical rotation . The PAS domain serves as the major sensor, while the DHp domain contains the conserved histidine residue that gets phosphorylated. The CA domain binds ATP and catalyzes the phosphorylation reaction .

How do sensor histidine kinases like SAS0199 typically function in two-component systems?

Sensor histidine kinases function as part of two-component systems (TCSs) that enable bacteria to respond to environmental stimuli. The general mechanism involves:

  • Detection of environmental signals through the sensor domain

  • Signal transduction through the HAMP domain

  • Conformational changes in the DHp domain

  • Phosphorylation of a conserved histidine residue in the DHp domain

  • Transfer of the phosphoryl group to an aspartate residue in the cognate response regulator

  • Activation of the response regulator, leading to altered gene expression or protein activity

Based on structural studies of VicK, histidine kinases likely activate through a sequential mechanism involving helical bending of the DHp domain and repositioning of the CA domains to access the conserved histidine residue . This activation is not simultaneous for both monomers in the dimer, as the DHp domain allows only one helix to bend at a time .

What methods are recommended for expressing and purifying recombinant SAS0199?

For successful expression and purification of recombinant SAS0199, consider the following methodological approach:

Expression System:

  • E. coli BL21(DE3) or similar strain designed for protein expression

  • pET-based vectors with affinity tags (His6, GST, or MBP) to facilitate purification

  • If expressing the full-length protein (including transmembrane domain) is challenging, express individual domains separately

Expression Conditions:

  • Induction with 0.1-0.5 mM IPTG at lower temperatures (16-25°C) to improve protein folding

  • Extended expression time (12-18 hours) for better yield

Purification Protocol:

  • Cell lysis using sonication or French press in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and protease inhibitors

  • Affinity chromatography using Ni-NTA (for His-tagged protein)

  • Size exclusion chromatography to remove aggregates

  • Ion-exchange chromatography for final purification

For functional studies, ensure the protein contains the necessary cofactors (ATP, Mg²⁺) and preserves the dimeric state of the histidine kinase, which is essential for its activity .

What experimental approaches can identify the activating signals for SAS0199?

Identifying the activating signals for an uncharacterized histidine kinase like SAS0199 requires a multi-faceted approach:

In vitro phosphorylation assays:

  • Expose purified SAS0199 to various potential stimuli (pH changes, ions, redox agents, antimicrobial compounds)

  • Measure autophosphorylation using γ-³²P-ATP

  • Monitor changes in phosphorylation state via Phos-tag gel mobility shift assays (PMS) or HPLC

Domain swap experiments:

  • Create chimeric proteins with the sensing domain of SAS0199 and the well-characterized kinase domains from another histidine kinase

  • Test if known stimuli for other histidine kinases activate the chimeric protein

Transcriptional reporter assays:

  • Construct reporter systems where the cognate response regulator controls expression of a reporter gene

  • Screen for conditions that activate the signaling pathway

Structural analysis:

  • Determine the crystal structure of the PAS domain with and without potential ligands

  • Identify conformational changes upon ligand binding

Table 1: Potential Environmental Signals for Testing SAS0199 Activation

CategorySpecific SignalsTesting Concentration RangeDetection Method
Redox signalsH₂O₂, Nitric oxide, Oxygen0.1-10 mMAutophosphorylation assay
Antimicrobialsβ-lactams, Glycopeptides0.1-10× MICIn vivo reporter system
Host factorsDefensins, Neutrophil components1-100 μg/mlPhosphotransfer assay
MetabolitesTCA cycle intermediates0.1-10 mMThermal shift assay
IonsCa²⁺, Mg²⁺, Fe²⁺, Zn²⁺0.1-10 mMCircular dichroism

How can the cognate response regulator of SAS0199 be identified?

Identifying the cognate response regulator (RR) for SAS0199 is crucial for understanding its signaling pathway. Consider these methodological approaches:

Genomic context analysis:

  • Examine the genomic neighborhood of SAS0199 for co-localized response regulator genes

  • Analyze operonic structures and potential co-transcription

In vitro phosphotransfer profiling:

  • Express and purify all response regulators from S. aureus

  • Perform phosphotransfer assays from autophosphorylated SAS0199 to each RR

  • Measure phosphotransfer kinetics to identify the preferred partner

In vivo studies:

  • Create knockout mutants of SAS0199 and candidate RRs

  • Compare phenotypes and transcriptional profiles

  • Perform epistasis analysis to establish pathway hierarchy

Bacterial two-hybrid assays:

  • Test direct protein-protein interactions between SAS0199 and candidate RRs

  • Confirm interactions using co-immunoprecipitation

Phosphatase activity testing:

  • Examine whether SAS0199 can dephosphorylate specific phosphorylated RRs

  • As shown with VicK, phosphatase activity requires ATP and is specific to its cognate RR

What mutations in SAS0199 might affect its kinase or phosphatase activities?

Based on structural and functional studies of VicK, several key residues are likely critical for SAS0199 function:

DHp domain mutations:

  • The conserved histidine (equivalent to His217 in VicK) is essential for phosphorylation

  • Proline residues adjacent to the conserved histidine (equivalent to Pro222 in VicK) are crucial for phosphatase activity

  • Mutations in the helical bending region (equivalent to Val212, Val215, Ser213, Ser216 in VicK) may affect autokinase activity

CA domain mutations:

  • Residues forming hydrogen bonds between CA and DHp domains (equivalent to D326/Q330 and R382/R385 in VicK) are essential for autokinase activity

  • ATP-binding pocket mutations would abolish kinase activity

Table 2: Critical Residues for Histidine Kinase Function Based on VicK Studies

DomainResidue TypeEffect of MutationFunction
DHpConserved histidineEliminates autokinase activityPhosphoryl acceptor
DHpProline adjacent to histidineEliminates phosphatase activityHelical bending
DHpLow helical propensity regionReduces autokinase activityConformational flexibility
CA-DHp interfaceD326/Q330, R382/R385 (VicK)Eliminates autokinase activityInterface stabilization
CAATP-binding pocketReduces autokinase activityATP binding

Testing these equivalent mutations in SAS0199 would provide valuable insights into its catalytic mechanism and structural dynamics .

How can crystal structures of SAS0199 domains be obtained?

Obtaining crystal structures of SAS0199 domains requires careful planning and optimization:

Domain boundary optimization:

  • Perform bioinformatic analyses to predict domain boundaries

  • Create multiple constructs with different start/end points

  • Test each construct for expression, solubility, and stability

Protein production and purification:

  • Express domains separately (HAMP, PAS, DHp-CA)

  • Purify to high homogeneity (>95% purity)

  • Verify protein quality by dynamic light scattering and thermal shift assays

Crystallization strategies:

  • Perform high-throughput crystallization screening (500-1000 conditions)

  • For the CA domain, include non-hydrolyzable ATP analogs

  • For the DHp domain, consider co-crystallization with cognate response regulator

  • For the sensor domain, test various potential ligands

Structure determination approaches:

  • Molecular replacement using homologous structures (e.g., VicK from S. mutans )

  • Heavy atom derivatives if molecular replacement fails

  • X-ray diffraction at synchrotron facilities for high-resolution data

Structure validation:

  • Structure-guided mutagenesis to confirm functional importance of key residues

  • Biophysical assays (circular dichroism, thermal shift) to verify structural integrity of mutants

As demonstrated with VicK, a careful strategy led to the determination of a complete cytoplasmic portion structure, revealing important insights about domain organization and activation mechanism .

What is the potential role of SAS0199 in S. aureus virulence and antibiotic resistance?

As a sensor histidine kinase, SAS0199 likely contributes to S. aureus adaptation to host environments and stress conditions:

Infection microenvironment sensing:

  • Detection of host defense molecules (antimicrobial peptides, reactive oxygen species)

  • Adaptation to changing nutrient availability in different host niches

  • Response to pH changes in infection sites

Contribution to antibiotic resistance:

  • Sensing cell wall stress induced by antibiotics

  • Activation of cell wall repair pathways

  • Regulation of efflux pump expression

Role in DNA damage response:

  • S. aureus DNA repair mechanisms contribute to pathogen survival in host tissues

  • Two-component systems may coordinate DNA repair with other stress responses

  • Activation of the SOS response, which promotes mutability and adaptation

Experimental approaches to investigate these roles:

  • Create SAS0199 deletion mutants and assess virulence in animal models

  • Determine transcriptional profiles of wild-type vs. mutant strains under infection-relevant conditions

  • Assess minimum inhibitory concentrations (MICs) of various antibiotics

  • Evaluate mutant survival in neutrophil killing assays

  • Monitor DNA damage response activation using reporter systems

Given the growing evidence that DNA repair contributes significantly to S. aureus survival in host tissues , investigating the potential connection between SAS0199 signaling and DNA repair pathways would be particularly valuable.

How should experiments be designed to elucidate SAS0199 function in S. aureus?

A systematic experimental design approach is crucial for characterizing SAS0199 function:

Factorial design approach:

  • Identify key factors that might influence SAS0199 activity (pH, temperature, ionic conditions, growth phase)

  • Design experiments with these factors at appropriate levels

  • Use statistical methods to analyze the effects and interactions of these factors

Response variables to consider:

  • SAS0199 phosphorylation state

  • Transcriptional changes of target genes

  • Phenotypic outcomes (antibiotic resistance, virulence)

Sample experimental design matrix:

Table 3: 2³ Factorial Design for SAS0199 Activation Conditions

RunpH (6.0/7.4)NaCl (150/300 mM)H₂O₂ (0/1 mM)Response (Phosphorylation %)
16.01500(To be determined)
27.41500(To be determined)
36.03000(To be determined)
47.43000(To be determined)
56.01501(To be determined)
67.41501(To be determined)
76.03001(To be determined)
87.43001(To be determined)

Analyze data using response surface methodology to identify optimal conditions and interactions between factors .

How can phosphorylation dynamics of SAS0199 be accurately measured?

Measuring phosphorylation dynamics requires sensitive and time-resolved methods:

In vitro methods:

  • Radiolabeling assays using γ-³²P-ATP

  • Phos-tag gel mobility shift assays (PMS) as used for VicK phosphatase activity analysis

  • HPLC-based separation of phosphorylated and non-phosphorylated proteins

  • Mass spectrometry to precisely quantify phosphorylation sites and levels

In vivo methods:

  • Phospho-specific antibodies against the conserved histidine residue

  • FRET-based biosensors to monitor conformational changes associated with phosphorylation

  • Time-resolved studies using rapid sampling techniques

  • Pulse-chase experiments to determine phosphorylation kinetics

Data analysis approaches:

  • Fit kinetic data to appropriate mathematical models

  • Compare phosphorylation and dephosphorylation rates under different conditions

  • Correlate phosphorylation dynamics with downstream response activation

When designing these experiments, it's important to note that histidine phosphorylation is relatively unstable at acidic pH, requiring careful sample handling and rapid analysis techniques.

How does SAS0199 compare to histidine kinases in other pathogenic bacteria?

Comparative analysis of SAS0199 with well-characterized histidine kinases provides valuable insights:

Sequence analysis:

  • Multiple sequence alignment with histidine kinases from different bacterial species

  • Phylogenetic analysis to identify closest homologs

  • Conservation analysis of key functional residues

Structural comparison:

  • Homology modeling based on structures like VicK from S. mutans

  • Domain architecture analysis

  • Identification of unique structural features

Functional comparison:

  • Analysis of known stimuli for homologous kinases

  • Comparison of phosphotransfer specificity

  • Regulatory network analysis

Evolutionary considerations:

  • Acquisition through horizontal gene transfer vs. vertical inheritance

  • Selection pressure analysis using dN/dS ratios

  • Identification of species-specific adaptations

Table 4: Comparison of Selected Bacterial Sensor Histidine Kinases

Histidine KinaseOrganismStimulusResponse RegulatorBiological Function
VicKS. mutansCell wall stressVicRCell division, biofilm formation
PhoQE. coliMg²⁺ limitationPhoPVirulence, membrane modification
DesKB. subtilisTemperatureDesRMembrane fluidity regulation
SAS0199S. aureusUnknownUnknownTo be determined

Understanding the similarities and differences between SAS0199 and other histidine kinases can guide experimental design and suggest potential functions based on homology.

How to resolve contradictory data regarding SAS0199 function?

When faced with contradictory data about SAS0199 function, employ these methodological approaches:

Technical verification:

  • Assess reproducibility across different laboratories

  • Standardize experimental conditions and protocols

  • Verify reagent quality and specificity

Biological context considerations:

  • Evaluate strain-specific differences in S. aureus

  • Consider growth conditions and environmental influences

  • Examine potential redundancy with other histidine kinases

Reconciliation strategies:

  • Perform comprehensive dose-response and time-course analyses

  • Test multiple stimuli simultaneously to identify synergistic or antagonistic effects

  • Develop mathematical models that can account for seemingly contradictory observations

  • Consider post-translational modifications or interactions with other proteins

Experimental design approach:

  • Apply factorial design principles to systematically evaluate factors that might explain contradictions

  • Use appropriate statistical methods to analyze complex datasets

  • Consider random and fixed effects in experimental design to account for variability

By applying rigorous experimental design principles and statistical analysis, researchers can identify the sources of apparent contradictions and develop a more accurate understanding of SAS0199 function.

What are the most promising targets for therapeutic intervention targeting SAS0199?

Based on structural and functional studies of histidine kinases, several promising targets emerge:

ATP-binding pocket:

  • Develop small molecules that compete with ATP binding

  • Target conserved residues in the CA domain

  • Design compounds that stabilize inactive conformations

Phosphorylation transfer interface:

  • Target the interface between DHp and CA domains

  • Disrupt the helical bending mechanism essential for autokinase activity

  • Inhibit interaction with cognate response regulator

Sensor domain:

  • Design molecules that mimic inhibitory signals

  • Target the PAS domain-ligand binding site

  • Disrupt signal transduction to the kinase domain

Domain-domain interactions:

  • Target the interfaces between HAMP, PAS, and DHp domains

  • Disrupt conformational changes required for signal transduction

  • Stabilize inactive domain arrangements

Inhibiting SAS0199 could potentially sensitize S. aureus to host defenses and antibiotics, similar to the concept that DNA repair inhibition could enhance antimicrobial susceptibility .

What new technologies might advance our understanding of SAS0199 function?

Emerging technologies offer new opportunities for understanding SAS0199:

Cryo-electron microscopy:

  • Determine full-length structures including transmembrane regions

  • Capture different conformational states during activation

Single-molecule techniques:

  • FRET-based analysis of conformational changes

  • Real-time monitoring of phosphorylation events

  • Direct observation of protein dynamics

Optogenetics:

  • Engineer light-sensitive domains into SAS0199

  • Control activation with spatial and temporal precision

  • Study downstream effects in real-time

CRISPR-based approaches:

  • CRISPRi for fine-tuned gene expression control

  • Base editors for introducing specific point mutations

  • Genetic screens to identify interacting proteins

High-throughput phenotypic screening:

  • Microfluidic-based approaches for single-cell analysis

  • Multiplexed assays for simultaneous testing of multiple conditions

  • Advanced imaging techniques for real-time monitoring

These technologies, combined with traditional biochemical and genetic approaches, will provide a comprehensive understanding of SAS0199 function and its potential as a therapeutic target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.