Recombinant Staphylococcus aureus Uncharacterized sensor-like histidine kinase SAUSA300_0218 (SAUSA300_0218)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
hptS; SAUSA300_0218; Sensor protein kinase HptS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-518
Protein Length
full length protein
Species
Staphylococcus aureus (strain USA300)
Target Names
SAUSA300_0218
Target Protein Sequence
MTAYKPYRHQLRRSLFASTIFPVFLVIIIGLVSFYAIYIWIEHRTIHQHVDESQSSLHHT EKQIQTFITQHNNSFQELDLTNHHDVTATKRELLKLIHQQPATLYYELSGPNQFITNNYE HLNTKNMYLFSTHQLKFKNSTYMLKIYMANTPRLSEIKKDNRQFALIVDQYDNILYANDD RFTIGEKYRPQQFGFMNESVKLNHADHRLIIYKDIHENIEDGITLLIVMAVVLVLLVIFG FISADNMAKRQTKDIETIIQKIYYAKNRHLGTYTPLKNNSELEEINNYIYDLFESNEQLI HSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQYLITLSPKLAQTVVQQLSQMLRYSL RTNSHTVELNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMMLQPLIENAIK HGRDTESLDITIRLTLARQNLHVLVCDNGIGMSSSRLQYVRQSLNNDVFDTKHLGLNHLH NKAMIQYGSHARLHIFSKRNQGTLICYKIPLSRGNVDV
Uniprot No.

Target Background

Function
SAUSA300_0218 is a histidine kinase belonging to the HptS/HptR two-component regulatory system in *Staphylococcus aureus*. This system regulates genes involved in hexose phosphate transport, responding to changes in extracellular phosphate levels. SAUSA300_0218 likely functions as a sensor kinase, undergoing autophosphorylation at a histidine residue before transferring the phosphate to the HptS response regulator. HptS, in turn, counteracts CcpA-dependent transcription of certain genes influencing antibiotic susceptibility.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.