Recombinant Staphylococcus aureus Uncharacterized sensor-like histidine kinase SAV0224 (SAV0224)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
hptS; SAV0224; Sensor protein kinase HptS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-518
Protein Length
full length protein
Species
Staphylococcus aureus (strain Mu50 / ATCC 700699)
Target Names
SAV0224
Target Protein Sequence
MTAYKPYRHQLRRSLFASTIFPVFLVIIIGLVSFYAIYIWIEHRTIHQHVDESQSSLHHT EKQIQTFITQHNNSFQELDLTNHHDVTATKRELLKLIHQQPATLYYELSGPNQFITNNYE HLNTKNMYLFSTHQLKFNNSTYMLKIYMANTPRLSEIKKDSRQFALIVDQYDNILYANDD RFTIGEKYRPQQFGFMNESVKLNHADHRLIIYKDIHENIEDGITLLIVMAVVLVLLVIFG FISADNMAKRQTKDIETIIQKIYYAKNRHLGTYTPLKNNSELEEINNYIYDLFESNEQLI HSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQYLITLSPKLAQTVVQQLSQMLRYSL RTNSHTVELNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMMLQPLIENAIK HGRDTESLDITIRLTLARQNLHVLVCDNGIGMSSSRLQYVRQSLNNDVFDTKHLGLNHLH NKAMIQYGSHARLHIFSKRNQGTLICYKIPLSRGNVDV
Uniprot No.

Target Background

Function

SAV0224 is a member of the two-component regulatory system HptS/HptR in Staphylococcus aureus. This system regulates genes involved in hexose phosphate transport, responding to changes in extracellular phosphate levels. SAV0224 likely functions as a sensor protein kinase, undergoing autophosphorylation at a histidine residue before transferring the phosphate to a conserved aspartic acid residue in the HptS regulatory domain. HptS, in turn, counteracts CcpA-dependent transcription of certain CcpA-regulated genes impacting antibiotic susceptibility.

Database Links

KEGG: sav:SAV0224

STRING: 158878.SAV0224

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of SAV0224 histidine kinase in Staphylococcus aureus?

SAV0224 is an uncharacterized sensor-like histidine kinase in Staphylococcus aureus strain Mu50/ATCC 700699 (UniProt ID: Q99WZ9). As with other sensor histidine kinases (SHKs), it likely functions as part of a two-component signaling system (TCS) that enables bacterial adaptation to environmental changes .

Histidine kinases typically act as environmental sensors that undergo autophosphorylation at a conserved histidine residue in response to specific stimuli. This phosphoryl group is then transferred to a response regulator, which mediates downstream effects, often through transcriptional regulation . Based on structural and sequence analysis, SAV0224 contains:

  • A transmembrane domain that anchors the protein to the bacterial membrane

  • A sensor domain that likely detects specific environmental signals

  • A histidine phosphotransferase domain containing the conserved histidine residue (H-box)

  • A catalytic ATP-binding domain

Like other histidine kinases, SAV0224 likely plays a role in S. aureus stress response, antibiotic resistance, or virulence factor regulation, though specific pathways remain to be elucidated through targeted research .

How is SAV0224 protein expression regulated in S. aureus?

The expression of SAV0224, like many bacterial sensor kinases, is likely regulated in response to specific environmental conditions. While direct regulatory data for SAV0224 is limited, research on other S. aureus histidine kinases suggests several potential regulatory mechanisms:

  • Environmental stress response: Expression may be upregulated during specific environmental stresses, such as nutrient limitation, pH changes, or antibiotic exposure

  • Growth phase-dependent regulation: Expression patterns may vary between exponential and stationary phases of bacterial growth

  • Regulatory networks: Expression may be controlled by global regulatory systems such as the SigB stress response regulator, which has been shown to influence the expression of multiple S. aureus genes during adaptation

Methodological approach for investigation:

  • Quantitative RT-PCR analysis of SAV0224 gene expression under various growth conditions

  • Reporter gene fusions (e.g., SAV0224 promoter-GFP) to monitor expression in real-time

  • RNA-seq analysis comparing expression in wild-type vs. regulatory mutant strains

  • Western blotting with anti-SAV0224 antibodies to quantify protein levels under different conditions

What are the optimal conditions for expressing recombinant SAV0224 protein?

Expressing functional recombinant histidine kinases presents several challenges due to their membrane-associated nature and complex domain structure. Based on protocols for similar S. aureus proteins, the following approach is recommended:

Expression system selection:

  • E. coli BL21(DE3) or derivatives are typically suitable for cytoplasmic domain expression

  • For full-length membrane protein expression, C41(DE3) or C43(DE3) strains may yield better results

  • Consider codon optimization for E. coli if expressing the full-length protein

Expression vector considerations:

  • pET series vectors with T7 promoter for high-level expression

  • Include a cleavable His-tag or other affinity tag for purification

  • Consider a fusion partner (MBP, SUMO, or TRX) to enhance solubility

Expression conditions:

  • Lower temperatures (16-20°C) after induction to improve proper folding

  • Reduced IPTG concentration (0.1-0.5 mM) for slower, more controlled expression

  • Rich media (e.g., TB or auto-induction media) to support higher cell density

Domain-based expression strategy:
For challenging membrane proteins like SAV0224, a domain-based approach may be more successful:

DomainResiduesExpression StrategyPurification Approach
Sensor domainVariablePeriplasmic expression with signal sequenceOsmotic shock followed by affinity chromatography
Cytoplasmic kinase domain1-518 (full protein)Cytoplasmic expressionIMAC followed by size exclusion chromatography
Transmembrane domainAnalysis requiredMembrane fraction isolationDetergent solubilization and purification

As demonstrated with other histidine kinases, the isolated cytoplasmic domains often retain enzymatic activity comparable to full-length proteins, making them suitable for biochemical and structural studies .

How can structure-function relationships of SAV0224 be analyzed?

Understanding the structure-function relationships of SAV0224 requires a multi-faceted approach:

1. Bioinformatic prediction and modeling:

  • Sequence alignment with characterized histidine kinases

  • Secondary structure prediction

  • Homology modeling based on related kinases with solved structures

  • Identification of conserved residues and motifs (H-box, N-box, G-boxes)

2. Domain mapping and mutational analysis:

  • Generate truncated variants to identify minimal functional domains

  • Create point mutations in key residues:

    • Conserved histidine in the H-box (autophosphorylation site)

    • ATP-binding residues in the catalytic domain

    • Potential dimerization interface residues

  • Assess impact on kinase activity, phosphotransfer, and signal transduction

3. Structural characterization:

  • X-ray crystallography of individual domains or full cytoplasmic region

  • Cryo-EM for full-length protein if possible

  • NMR for dynamic studies of specific domains

  • Small-angle X-ray scattering (SAXS) for solution-state conformational analysis

Based on insights from ZraS crystallization (search result ), consider:

  • Exploring asymmetric dimer arrangements

  • Analysis of conformational changes during different signaling states

  • Identification of potential ligand-binding sites

4. Conformational dynamics analysis:
Research on other histidine kinases suggests SAV0224 likely undergoes significant conformational changes during signaling. Methods to investigate include:

  • Hydrogen-deuterium exchange mass spectrometry

  • Site-directed spin labeling coupled with EPR

  • FRET-based sensors to monitor conformational states in vitro or in vivo

How might SAV0224 contribute to S. aureus pathogenesis and antibiotic resistance?

Histidine kinases in S. aureus have been implicated in virulence regulation and antibiotic resistance. Although SAV0224's specific role remains uncharacterized, several experimental approaches can investigate its potential contributions:

1. Genetic manipulation approaches:

  • Generate SAV0224 deletion or point mutant strains

  • Complement mutants with wild-type or modified SAV0224

  • Compare phenotypes in infection models and antibiotic susceptibility tests

2. Infection model analysis:

  • Macrophage survival assay: As described in search result , assess intracellular survival of wild-type vs. SAV0224 mutant strains in macrophages

  • Blood survival assay: Compare survival in human blood to assess immune evasion capabilities

  • Animal infection models: Evaluate colonization, dissemination, and persistence

3. Antibiotic resistance phenotyping:

  • Determine minimum inhibitory concentrations (MICs) for various antibiotics

  • Assess development of resistance under selective pressure

  • Investigate potential interactions with known resistance mechanisms

4. Transcriptomic and proteomic analysis:

  • Compare gene/protein expression profiles between wild-type and SAV0224 mutants

  • Identify regulated genes involved in virulence or resistance

  • Map the SAV0224 regulon through ChIP-seq of its cognate response regulator

5. Potential relationships to vancomycin resistance:
Search result describes an evolved S. aureus variant with enhanced macrophage survival and vancomycin-intermediate resistance. If SAV0224 is involved in similar pathways, it may:

  • Regulate cell wall biosynthesis or remodeling

  • Influence membrane permeability

  • Modulate stress response pathways that confer antibiotic tolerance

What role might SAV0224 play in S. aureus adaptation during host colonization?

S. aureus is known to adapt during host colonization through various mechanisms. SAV0224, as a sensor histidine kinase, may contribute to this adaptation process:

1. Experimental evolution approaches:
Based on the nasopharyngeal colonization model described in search result :

  • Compare wild-type and SAV0224 mutant strains during serial passage in mice

  • Analyze genomic changes through whole-genome sequencing

  • Identify selective pressures that influence SAV0224 expression or mutation

2. Host-specific signal detection:

  • Identify potential host signals sensed by SAV0224

  • Test candidate molecules (antimicrobial peptides, host hormones, etc.) for activation

  • Analyze expression during different stages of infection or colonization

3. Phenotypic switching regulation:
Research from search result describes phenotypic switching in S. aureus during colonization:

  • Investigate if SAV0224 regulates small colony variant (SCV) formation

  • Assess role in pigmentation changes (hyper-pigmentation)

  • Determine involvement in biofilm formation during adaptation

4. Co-infection dynamics:
Based on research in search result on S. aureus-viral co-infections:

  • Investigate if SAV0224 senses or responds to co-infecting pathogens

  • Determine if it regulates expression of factors like IsdA that influence co-infection dynamics

  • Test if it contributes to altered growth or virulence during polymicrobial infections

How can SAV0224 be targeted for novel antimicrobial development?

Given the absence of histidine kinases in humans and their importance in bacterial physiology, SAV0224 represents a potential target for antimicrobial development. Several approaches can be considered:

1. Structure-based inhibitor design:

  • Use structural data (predicted or experimental) to identify druggable pockets

  • Focus on ATP-binding site for competitive inhibitors

  • Target sensor domain to prevent signal detection

  • Explore allosteric sites to lock protein in inactive conformation

2. High-throughput screening approaches:

  • Develop biochemical assays suitable for screening compound libraries

  • Design cell-based reporter systems to identify inhibitors in a cellular context

  • Use fragment-based screening to identify starting points for inhibitor development

3. Validation in resistant S. aureus strains:

  • Test efficacy against clinical isolates with various resistance profiles

  • Evaluate potential for resistance development through serial passage

  • Combine with existing antibiotics to assess synergistic potential

4. Immunological targeting approaches:
Based on vaccine development information in search results and :

  • Assess SAV0224 as a potential vaccine antigen

  • Determine surface accessibility of sensor domain

  • Evaluate immunogenicity and protective efficacy in animal models

  • Consider as component of multi-antigen vaccine formulation

Table: Advantages and Challenges of Different SAV0224 Targeting Approaches

ApproachAdvantagesChallengesPotential Solutions
Small molecule inhibitors- High specificity
- Oral bioavailability
- Potential broad-spectrum activity
- Development of resistance
- Limited structural data
- Membrane permeability
- Target conserved domains
- Combination therapy
- Prodrug approaches
Peptide inhibitors- High specificity
- Target protein-protein interactions
- Lower resistance potential
- Stability issues
- Delivery challenges
- Manufacturing costs
- Cyclization strategies
- Lipidation for delivery
- Non-natural amino acids
Vaccine approach- Stimulates host immunity
- Long-term protection
- Complements antibiotic therapy
- Variable expression levels
- Strain variation
- Immune evasion
- Multiple epitope targeting
- Adjuvant optimization
- Combination with other antigens

What are the best approaches for studying SAV0224 signaling pathways?

Understanding the complete signaling pathway of SAV0224 requires identification of both upstream signals and downstream targets:

1. Cognate response regulator identification:

  • Bioinformatic analysis of genomic context

  • Bacterial two-hybrid or pull-down assays to identify interaction partners

  • Phosphotransfer profiling with multiple response regulators

  • Epistasis analysis with candidate response regulator mutants

2. Stimulus identification:

  • Environmental sensing: Test various conditions (pH, temperature, ionic strength)

  • Chemical sensing: Screen candidate molecules (metals, metabolites, antibiotics)

  • Host factor sensing: Examine host-derived molecules (antimicrobial peptides, hormones)

3. Transcriptomic approaches:

  • RNA-seq comparing wild-type and SAV0224 mutant strains under various conditions

  • ChIP-seq of response regulator to identify binding sites

  • Time-course analysis following stimulus exposure to capture direct vs. indirect effects

4. Phosphoproteomics:

  • Quantitative phosphoproteomic analysis of wild-type vs. mutant strains

  • Identification of proteins with differential phosphorylation

  • Temporal dynamics of signaling cascade activation

5. Reconstitution approaches:
Based on research from search results and on other bacterial two-component systems:

  • In vitro reconstitution with purified components

  • Cell-based reporter systems

  • FRET-based sensors to monitor protein interactions and conformational changes in real-time

What methodological considerations are important when investigating SAV0224 interactions with host factors?

Investigating interactions between bacterial sensor proteins and host factors presents unique challenges:

1. Detection of direct interactions:

  • Surface plasmon resonance (SPR) with purified SAV0224 sensor domain and candidate ligands

  • Isothermal titration calorimetry (ITC) for binding affinity and thermodynamics

  • Pull-down assays with immobilized host factors

  • Cross-linking followed by mass spectrometry to capture transient interactions

2. Host cell models:
Based on approaches in search results and :

  • Macrophage infection models to assess intracellular survival

  • Epithelial cell adhesion and invasion assays

  • Co-culture systems to model complex host environments

  • Ex vivo tissue models to approximate natural infection sites

3. In vivo approaches:

  • Animal models with varying immune backgrounds

  • Humanized mouse models for human-specific interactions

  • In vivo imaging to track bacterial adaptation during infection

  • Host-pathogen transcriptomics to capture dual perspective

4. Systems biology integration:

  • Network analysis incorporating both bacterial and host factors

  • Dual RNA-seq during infection

  • Interactome mapping across species boundaries

  • Mathematical modeling of signal transduction dynamics

5. Avoiding experimental artifacts:

  • Careful control of expression levels

  • Validation in multiple experimental systems

  • Correlation with clinical observations

  • Consideration of strain background effects on phenotype

How can the membrane localization challenges of SAV0224 be overcome for structural studies?

Membrane proteins like SAV0224 present significant challenges for structural and functional studies:

1. Domain-based approaches:

  • Express and study individual domains separately

  • Focus on cytoplasmic domains for initial characterization

  • Use soluble chimeric constructs replacing transmembrane segments

2. Membrane mimetic systems:

  • Detergent solubilization optimization (screen multiple detergents)

  • Nanodiscs for native-like lipid environment

  • Liposome reconstitution for functional studies

  • Amphipols as alternative to detergents

3. Crystallization strategies:
Based on successful approaches with other histidine kinases in search result :

  • Lipidic cubic phase crystallization

  • Antibody fragment co-crystallization to stabilize conformations

  • Surface entropy reduction mutations to promote crystal contacts

  • Truncation series to identify minimal crystallizable fragments

4. Alternative structural methods:

  • Cryo-EM for full-length protein structure

  • Solid-state NMR for membrane-embedded domains

  • Hydrogen-deuterium exchange mass spectrometry for dynamics

  • Computational modeling integrated with sparse experimental constraints

What quality control measures are essential for recombinant SAV0224 protein production?

Ensuring high-quality recombinant SAV0224 is critical for reliable research outcomes:

1. Expression optimization monitoring:

  • SDS-PAGE and western blot analysis of expression time course

  • Comparison of soluble vs. insoluble fractions

  • Assessment of expression host health and growth characteristics

2. Purification quality control:

  • Multi-step chromatography (IMAC, ion exchange, size exclusion)

  • Assessment of purity by SDS-PAGE, mass spectrometry

  • Verification of intact mass by ESI-MS or MALDI-TOF

  • Circular dichroism to confirm secondary structure content

3. Functional validation:

  • ATPase activity assays as described in section 2.2

  • Autophosphorylation capability using non-radioactive methods (Phos-tag SDS-PAGE)

  • Oligomeric state determination by size exclusion chromatography with multi-angle light scattering (SEC-MALS)

  • Thermal stability assessment by differential scanning fluorimetry

4. Storage stability assessment:

  • Activity retention after freeze-thaw cycles

  • Long-term storage conditions optimization

  • Aggregation monitoring by dynamic light scattering

  • Inclusion of appropriate stabilizers (glycerol, reducing agents)

Table: Quality Control Checklist for Recombinant SAV0224

ParameterMethodAcceptance Criteria
PuritySDS-PAGE, densitometry>95% purity
IdentityMass spectrometryMass within 0.1% of theoretical
Secondary structureCircular dichroismSpectral features consistent with predicted structure
Oligomeric stateSEC-MALSPredominantly dimeric (expected ~110-120 kDa)
ActivityATP hydrolysisSpecific activity comparable to other histidine kinases
StabilityThermal shift assayMelting temperature >40°C
HomogeneityDynamic light scatteringPolydispersity index <0.2

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.