Recombinant Staphylococcus aureus UPF0060 membrane protein SAHV_2323 (SAHV_2323)

Shipped with Ice Packs
In Stock

Description

Understanding UPF0060 Proteins

UPF0060 proteins belong to a group of uncharacterized proteins that are conserved across different bacterial species. They are typically membrane-associated and may play roles in maintaining membrane integrity or facilitating interactions with other proteins or molecules. The specific function of SAHV_2323 would require detailed biochemical and structural studies.

Recombinant Expression

Recombinant expression of proteins like SAHV_2323 involves cloning the gene into an expression vector and expressing it in a host organism, often Escherichia coli. This process allows for the production of large quantities of the protein for further study. Recombinant proteins are frequently tagged with markers like His-tags to facilitate purification and identification.

Research Findings and Challenges

While specific research findings on SAHV_2323 are not readily available, studies on similar UPF0060 proteins suggest that they may be involved in membrane organization and stability. Challenges in studying these proteins include their uncharacterized nature and the need for advanced structural and functional analyses.

Functional Membrane Microdomains in Staphylococcus aureus

In Staphylococcus aureus, membrane proteins often organize into functional membrane microdomains (FMMs), which are crucial for bacterial nutrient acquisition and pathogenicity. Proteins like IsdF, involved in heme transport, require specific localization within these microdomains to function effectively . While SAHV_2323's role in such microdomains is speculative, understanding its potential involvement could provide insights into its function.

Data Table: General Characteristics of Recombinant UPF0060 Membrane Proteins

CharacteristicDescription
Protein LengthTypically around 100-110 amino acids
Expression HostOften Escherichia coli
TagCommonly His-tagged for purification
FunctionPotential roles in membrane organization and stability
Structural AnalysisTechniques include X-ray crystallography and cryo-electron microscopy

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your specification.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us; we will prioritize development to meet your needs.
Synonyms
SAHV_2323; UPF0060 membrane protein SAHV_2323
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Staphylococcus aureus (strain Mu3 / ATCC 700698)
Target Names
SAHV_2323
Target Protein Sequence
MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGAILMLYGVIATFQSFPSFGRV YAAYGGVFIIMSLIFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.