Recombinant Staphylococcus aureus UPF0133 protein SAV0479 (SAV0479)

What is SAV0479 and how is it classified within the S. aureus proteome?

SAV0479 is a hypothetical protein from the methicillin- and vancomycin-resistant Staphylococcus aureus (MRSA) Mu50 strain. It belongs to the UPF0133 protein family, with limited functional characterization despite its presence in antibiotic-resistant pathogen strains. The protein was selected for structure and function determination as part of a structural genomics project aimed at understanding antibiotic-resistant pathogens and identifying potential targets for drug development . The protein contains 105 amino acids in its native form and has been identified as a potential target of interest due to its presence in clinically significant MRSA strains that demonstrate resistance to multiple antibiotics including potent β-lactams .

What is known about the amino acid sequence of SAV0479 and related S. aureus UPF0133 proteins?

The full amino acid sequence of SAV0479 from S. aureus Mu50 strain consists of 105 residues with the following sequence: MMRGGGNMQQMMKQMQKMQKKMAQEQEKLKEERIVGTAGGGMVAVTVTGHKEVVDVEIKEEAVDPDDIEMLQDLVLAATNEAMNKADELTQERLGKHTQGLNIPGM . A related protein, UPF0133 protein SaurJH9_0500 from S. aureus strain JH9, shares significant sequence homology with the following sequence: MRGGGNMQQMMKQMQKMQKKMAQEQKKLKEERIVGTAGGGMVAVTVTGHKEVVDVEIKEEAVDPDDIEMLQDLVLAATNEAMNKADELTQERLGKHTQGLNIPGM . The high sequence similarity between these proteins suggests conserved structural and possibly functional features across different S. aureus strains, though minor variations exist that may correlate with strain-specific properties or adaptations.

What are the optimal storage conditions for maintaining SAV0479 stability in laboratory settings?

For optimal stability of recombinant SAV0479, storage conditions depend on the protein formulation. For liquid preparations, the recommended storage is at -20°C/-80°C with an expected shelf life of approximately 6 months . Lyophilized preparations demonstrate greater stability with a shelf life of approximately 12 months when stored at -20°C/-80°C . To maintain protein integrity during experimental workflows, working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they significantly compromise protein stability . For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being most commonly used) before aliquoting and freezing the protein preparation .

What expression systems have proven effective for recombinant SAV0479 production?

Escherichia coli has been established as an effective expression system for recombinant SAV0479 production. The protein gene can be successfully cloned into the pET-21a(+) vector (Novagen) using NdeI/XhoI restriction sites and expressed in E. coli BL21(DE3) cells . This approach yields soluble protein with an approximate production rate of 10 mg per liter of LB medium, making it suitable for laboratory-scale production . The expression protocol typically involves growing cells at 310K until reaching an OD600 of 0.5, followed by induction with isopropyl β-D-1-thiogalactopyranoside (IPTG) at a final concentration of 0.5 mM and continuing incubation for an additional 4 hours . This methodology has demonstrated consistent results for producing recombinant SAV0479 in sufficient quantities for structural and functional studies.

What purification strategy yields high-purity SAV0479 suitable for crystallization studies?

A highly effective purification strategy for SAV0479 utilizes affinity chromatography with a C-terminal hexahistidine tag. The detailed methodology involves:

• Cell lysis in buffer containing 20 mM Tris-HCl, 500 mM NaCl, pH 7.9 using ultrasonication at 277K with a 3s ON/OFF cycle for 30 minutes

• Centrifugation at 6708 g for 1 hour to separate soluble proteins

• Filtration through a 0.45 μm membrane to remove insoluble particles

• Loading onto a Ni²⁺-NTA column pre-equilibrated with lysis buffer (approximately 3 ml resin per liter of original culture)

• Washing with 5× column volume of wash buffer (20 mM Tris-HCl, 500 mM NaCl, 60 mM imidazole, pH 7.9)

• Elution with a 0-0.5 M imidazole gradient

• Dialysis against final buffer (20 mM HEPES, 200 mM NaCl, 1 mM EDTA, 1 mM β-mercaptoethanol, 0.1 mM PMSF, pH 7.0)

This protocol consistently yields SAV0479 with greater than 95% purity as assessed by SDS-PAGE analysis, making the preparation suitable for crystallization and other high-resolution structural studies .

How can researchers optimize protein yield during recombinant SAV0479 expression?

What crystallization conditions have successfully yielded diffraction-quality SAV0479 crystals?

The most effective crystallization conditions reported for obtaining diffraction-quality SAV0479 crystals consist of 1.8 M NaCl, 0.1 M sodium acetate pH 4.2, and 1 mM taurine . These conditions produced crystals within 1-2 days using the hanging-drop vapor-diffusion method. For initial screening, a protein concentration of approximately 10 mg/ml has proven effective . The resulting crystals belonged to space group P3121, with unit-cell parameters a = b = 81.48, c = 82.53 Å, and diffracted to a resolution of 2.8 Å . Three monomers of SAV0479 were found to be present in each asymmetric unit, with a calculated crystal volume per protein weight (VM) of 2.04 ų Da⁻¹ and a solvent content of 39.89% . For researchers attempting crystallization, it is advisable to perform a comprehensive screening of crystallization conditions, testing various precipitants, buffers, additives, and protein concentrations to identify optimal crystal growth parameters.

How does the oligomeric state of SAV0479 affect structural and functional studies?

X-ray crystallographic analysis of SAV0479 revealed that three monomers are present in each asymmetric unit, suggesting the protein may function as a trimer in its native state . This oligomeric arrangement has significant implications for both structural and functional studies. When designing experiments, researchers should consider:

• Solution studies (size-exclusion chromatography, dynamic light scattering, analytical ultracentrifugation) to verify the oligomeric state in physiological conditions

• Crystal packing analysis to distinguish biologically relevant oligomers from crystal artifacts

• Interface analysis to identify key residues involved in oligomer formation

• Mutagenesis studies targeting interface residues to assess oligomerization effects on function

• Cross-linking experiments to stabilize native oligomeric states during purification

The presence of multiple monomers per asymmetric unit suggests potential cooperative mechanisms or structural features that may be essential for the protein's biological role. Understanding the quaternary structure is crucial for interpreting functional data and developing potential inhibitors for therapeutic applications .

What computational approaches can predict functional sites in SAV0479 based on structural data?

For SAV0479, which belongs to the UPF0133 protein family with limited functional characterization, computational approaches represent a valuable strategy for generating hypotheses about functional sites. Researchers should integrate multiple computational methods with experimental validation approaches such as site-directed mutagenesis of predicted functional residues followed by activity assays to comprehensively characterize the protein's function .

What experimental strategies can determine the biological function of SAV0479?

As SAV0479 remains a hypothetical protein with unknown function, a multi-faceted experimental approach is necessary to elucidate its biological role. Key experimental strategies include:

• Gene knockout/knockdown studies in S. aureus to observe phenotypic effects under various stress conditions, particularly antibiotic exposure

• Transcriptomic analysis comparing wild-type and knockout strains to identify affected pathways

• Pull-down assays coupled with mass spectrometry to identify interaction partners

• Metabolomic profiling to detect changes in metabolite levels associated with SAV0479 disruption

• Comparative growth studies between wild-type and mutant strains under various conditions (temperature, pH, nutrient limitation, antibiotic stress)

• Biochemical assays testing potential enzymatic activities based on structural similarities to known proteins

• Heterologous expression in susceptible S. aureus strains to assess potential contribution to antibiotic resistance

Since SAV0479 was identified in the methicillin- and vancomycin-resistant S. aureus Mu50 strain, special attention should be given to potential roles in antibiotic resistance mechanisms, cell wall synthesis, or stress response pathways .

How can researchers design effective mutational studies to identify functional residues in SAV0479?

Designing effective mutational studies for SAV0479 requires a strategic approach that maximizes functional insights while minimizing experimental effort. A comprehensive mutational analysis should include:

• Alanine scanning of conserved residues across UPF0133 family members, particularly those at the predicted active site or oligomerization interfaces

• Charge-swap mutations (e.g., changing acidic to basic residues and vice versa) to test the importance of electrostatic interactions

• Conservative substitutions to assess the structural versus functional roles of specific residues

• Domain swapping with homologous proteins from non-resistant strains to identify regions crucial for potential resistance mechanisms

• Introduction of premature stop codons to create truncated versions for domain function analysis

Each mutant should be characterized through multiple assays, including expression level assessment, structural integrity verification, oligomerization state determination, and functional testing. Given that SAV0479 was selected for study in the context of antibiotic resistance, particular attention should be paid to assessing how mutations affect any potential contribution to antibiotic tolerance mechanisms in S. aureus .

How might SAV0479 contribute to antibiotic resistance mechanisms in S. aureus?

While the precise function of SAV0479 in antibiotic resistance remains to be fully elucidated, several hypotheses can be formulated based on its presence in the methicillin- and vancomycin-resistant S. aureus Mu50 strain. Potential mechanisms by which SAV0479 might contribute to resistance include:

• Modification of cell wall components to reduce antibiotic binding or penetration

• Participation in stress response pathways activated during antibiotic exposure

• Direct or indirect interaction with known resistance determinants such as PBP2a (for methicillin resistance) or modified peptidoglycan precursors (for vancomycin resistance)

• Involvement in biofilm formation, which can enhance population-level antibiotic tolerance

• Contribution to membrane integrity or permeability regulation

The methicillin- and vancomycin-resistant S. aureus Mu50 strain is known to be resistant to nearly all antibiotics, including potent β-lactams . Understanding how hypothetical proteins like SAV0479 might contribute to this multi-drug resistance phenotype could reveal novel targets for combination therapies aimed at overcoming antibiotic resistance in clinical settings .

What comparative genomic approaches can identify the role of SAV0479 in antibiotic-resistant versus susceptible S. aureus strains?

To effectively apply these approaches to SAV0479, researchers should collect data from multiple S. aureus strains with well-characterized antibiotic susceptibility profiles, including the Mu50 strain (resistant to methicillin and vancomycin) and susceptible clinical isolates . The genomic context of SAV0479 and potential horizontal gene transfer events should be carefully analyzed to understand if the gene was acquired alongside known resistance determinants. Expression analysis during antibiotic exposure can provide valuable insights into the potential involvement of SAV0479 in stress response mechanisms related to antibiotic resistance .

How can researchers address protein aggregation issues during SAV0479 purification?

Protein aggregation represents a common challenge during purification of recombinant proteins like SAV0479. To address this issue, researchers can implement several strategies:

• Modify buffer conditions by testing different pH values (typically 6.5-8.0), salt concentrations (150-500 mM NaCl), and adding stabilizing agents such as glycerol (5-10%)

• Include reducing agents such as DTT or β-mercaptoethanol (1-5 mM) to prevent disulfide-mediated aggregation

• Add mild detergents below their critical micelle concentration (e.g., 0.05% Tween-20 or 0.1% Triton X-100)

• Decrease protein concentration during purification steps, particularly after elution from affinity columns

• Maintain all purification steps at 4°C and include protease inhibitors (e.g., 0.1 mM PMSF) to prevent degradation-induced aggregation

For SAV0479 specifically, the reported successful purification protocol included 1 mM β-mercaptoethanol and 1 mM EDTA in the final buffer, suggesting these additives help maintain protein stability . If aggregation persists despite these modifications, more dramatic approaches such as fusion to solubility-enhancing tags (MBP, SUMO, etc.) or refolding from inclusion bodies may be necessary.

What strategies can improve diffraction quality of SAV0479 crystals for high-resolution structural analysis?

For SAV0479 specifically, previous successful crystallization involved 1.8 M NaCl, 0.1 M sodium acetate pH 4.2, and 1 mM taurine . To improve upon the reported 2.8 Å resolution, researchers should systematically optimize these conditions, focusing particularly on fine pH gradients (4.0-4.4) and NaCl concentration (1.6-2.0 M). Since three monomers of SAV0479 are present in each asymmetric unit, conformational heterogeneity might limit resolution . Strategies that promote more uniform conformational states, such as ligand binding (if potential ligands can be identified) or surface entropy reduction mutagenesis, could potentially improve crystal quality.

How to verify the structural integrity and folding of purified SAV0479 before proceeding to functional assays?

Before proceeding to functional assays, it is crucial to verify that purified SAV0479 maintains its native structural integrity. Multiple complementary techniques should be employed:

• Circular Dichroism (CD) Spectroscopy: Provides information about secondary structure content and can detect significant conformational changes. The far-UV spectrum (190-260 nm) reveals secondary structure composition, while the near-UV spectrum (250-350 nm) reflects tertiary structure environment of aromatic residues.

• Thermal Shift Assays: Measures protein stability through unfolding transitions with increasing temperature. Well-folded proteins typically show cooperative unfolding with a distinct melting temperature (Tm).

• Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): Assesses oligomeric state and homogeneity in solution, particularly important given the trimeric arrangement of SAV0479 observed in crystal structures .

• Dynamic Light Scattering (DLS): Evaluates sample homogeneity and detects aggregation, with monodisperse samples indicating properly folded protein.

• Limited Proteolysis: Well-folded proteins show resistance to proteolytic digestion except at exposed flexible regions, generating a characteristic pattern of protected fragments.

For SAV0479 specifically, comparing experimental data with predictions based on the crystal structure can provide confidence that the recombinant protein maintains its native fold throughout purification and experimental procedures .