Recombinant Staphylococcus aureus UPF0316 protein MW1852 (MW1852)

Shipped with Ice Packs
In Stock

Description

Characteristics

CharacteristicDescription
SourceStaphylococcus aureus (strain MW2)
Product TypeRecombinant Protein
Uniprot IDP61545
Expression Region1-200
AA SequenceMSFVTENPWLMVLTIFIINVCYVTFLTMRTILTLKGYRYIAASVSFLEVLVYIVGLGLVM
SNLDHIQNIIAYAFGFSIGIIVGMKIEEKLALGYTVVNVTSAEYELDLPNELRNLGYGVT
HYAAFGRDGSRMVMQILTPRKYERKLMDTIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRK
LKDYEPEELESVVEHEIQSK
Tag InfoDetermined during production
PurityGreater than 90% as determined by SDS-PAGE
Storage BufferTris-based buffer, 50% glycerol, optimized for this protein
Storage ConditionStore at -20℃, for extended storage, conserve at -20℃ or -80℃. Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week .

Function and Research Applications

The Staphylococcus aureus UPF0316 protein MW1852 is a chemotaxis inhibitory protein (CHIPS) . CHIPS inhibits neutrophil chemotaxis, which is a key defense mechanism, thus providing the bacterium an advantage during infection .

Staphylococcus aureus vaccine research focuses on identifying novel vaccine formulations able to elicit potent humoral and cellular immune responses . Recombinant S. aureus antigens can be used in vaccines .

Role in Immune Evasion

Staphylococcus aureus utilizes various strategies to evade the host's immune system . One such mechanism involves the production of proteins that interfere with the normal function of immune cells .

  • Inhibition of Neutrophil Chemotaxis: The protein inhibits the movement of neutrophils, a type of white blood cell, towards the site of infection . By inhibiting neutrophil chemotaxis, S. aureus can delay or prevent the arrival of these immune cells, reducing the effectiveness of the host's immune response .

Recombinant Production

Recombinant Staphylococcus aureus UPF0316 protein MW1852 is produced using recombinant DNA technology . The DNA sequence encoding the protein is inserted into a suitable expression vector, which is then introduced into a host cell . The host cell, such as Escherichia coli, yeast, or mammalian cells, is cultured under conditions that promote protein expression . The recombinant protein is then purified from the host cell lysate using various biochemical techniques .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us; we will prioritize fulfilling your request.
Synonyms
MW1852; UPF0316 protein MW1852
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Staphylococcus aureus (strain MW2)
Target Names
MW1852
Target Protein Sequence
MSFVTENPWLMVLTIFIINVCYVTFLTMRTILTLKGYRYIAASVSFLEVLVYIVGLGLVM SNLDHIQNIIAYAFGFSIGIIVGMKIEEKLALGYTVVNVTSAEYELDLPNELRNLGYGVT HYAAFGRDGSRMVMQILTPRKYERKLMDTIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRK LKDYEPEELESVVEHEIQSK
Uniprot No.

Target Background

Database Links

KEGG: sam:MW1852

Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is recombinant MW1852 typically expressed and purified?

Recombinant MW1852 is commonly expressed in E. coli expression systems with N-terminal His-tag fusion for ease of purification. The typical expression protocol involves:

  • Cloning the MW1852 gene into an appropriate expression vector

  • Transforming E. coli host cells with the recombinant plasmid

  • Inducing protein expression under optimized conditions

  • Cell lysis and protein extraction

  • Purification using immobilized metal affinity chromatography (IMAC)

The protein is typically supplied as a lyophilized powder, which should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, it's recommended to add 5-50% glycerol (final concentration) and store in aliquots at -20°C/-80°C to avoid repeated freeze-thaw cycles .

What are the structural characteristics of MW1852 protein?

Based on sequence analysis and structural predictions, MW1852 exhibits the following characteristics:

FeatureDescription
Length200 amino acids
Molecular WeightApproximately 22-25 kDa
Structural MotifsMultiple transmembrane domains
Protein FamilyUPF0316 (Uncharacterized Protein Family)
Predicted Secondary StructureAlpha-helical transmembrane regions
ConservationConserved across different S. aureus strains

The protein contains hydrophobic regions characteristic of membrane proteins, suggesting it likely localizes to the bacterial cell membrane. Current structural data is limited, and high-resolution structures through X-ray crystallography or cryo-EM would significantly advance understanding of this protein's function .

What are the optimal conditions for soluble expression of recombinant MW1852 in E. coli?

Achieving soluble expression of membrane proteins like MW1852 can be challenging. Based on experimental design approaches used for similar proteins, the following optimized conditions are recommended:

ParameterOptimized Condition
Growth Medium5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, 1 g/L glucose
Antibiotic Selection30 μg/mL kanamycin
Growth Temperature37°C until induction, then 25°C post-induction
Induction OD6000.8
IPTG Concentration0.1 mM
Post-induction Time4 hours
Buffer CompositionTris/PBS-based buffer, pH 8.0 with 6% Trehalose

This factorial design approach, similar to that used for pneumolysin expression, can significantly improve soluble protein yield (potentially up to 250 mg/L) while maintaining proper folding and functional activity. Lower induction temperatures (25°C rather than 37°C) particularly help prevent inclusion body formation with membrane proteins .

How can researchers troubleshoot poor expression yields of MW1852?

When encountering low expression yields of MW1852, consider the following systematic troubleshooting approach:

  • Codon optimization: S. aureus has different codon usage than E. coli. Analyze the MW1852 gene sequence for rare codons and consider codon optimization for E. coli.

  • Expression vector selection: Test different vectors with various promoter strengths (T7, tac, etc.) and fusion tags (His, GST, MBP).

  • Host strain selection: Compare expression in different E. coli strains:

    • BL21(DE3) for general expression

    • Rosetta for rare codon optimization

    • C41/C43 specifically designed for membrane proteins

  • Induction parameters: Systematically vary:

    • IPTG concentration (0.01-1.0 mM)

    • Induction temperature (16°C, 25°C, 30°C)

    • Duration (4h vs. overnight)

  • Solubilization strategies: For membrane proteins, test various detergents:

    • Mild detergents (DDM, LDAO)

    • Zwitterionic detergents (CHAPS)

    • Lipid-like peptides

Implementing a factorial design experiment allows simultaneous evaluation of multiple variables to identify optimal conditions for MW1852 expression .

What are the best methods to assess the functional activity of recombinant MW1852?

Since MW1852 is an uncharacterized protein, assessing its functional activity presents unique challenges. Consider these approaches:

  • Binding assays: Test interaction with known S. aureus membrane or periplasmic components using:

    • Pull-down assays with potential binding partners

    • Surface plasmon resonance (SPR)

    • Isothermal titration calorimetry (ITC)

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure

    • Size exclusion chromatography to verify monomeric/oligomeric state

    • Thermal shift assays to evaluate protein stability

  • Functional predictions based on homology:

    • Test predicted biochemical activities (e.g., ATPase, phosphatase activity)

    • Membrane reconstitution experiments if transport function is suspected

    • Liposome binding assays

  • In vivo functional complementation:

    • Generate MW1852 deletion mutants in S. aureus

    • Test whether recombinant protein can rescue mutant phenotypes

A combination of these methods provides a comprehensive assessment of recombinant MW1852 functionality and potential biological roles .

How might MW1852 contribute to Staphylococcus aureus pathogenesis?

Although MW1852's specific role in S. aureus pathogenesis isn't fully characterized, several lines of evidence suggest potential contributions:

  • Membrane localization: As a predicted membrane protein, MW1852 may participate in:

    • Host-pathogen interactions

    • Nutrient acquisition

    • Antimicrobial resistance

    • Biofilm formation

  • Conservation across strains: The protein is conserved across S. aureus strains, suggesting functional importance for bacterial survival or virulence.

  • Potential immune evasion: Like other S. aureus membrane proteins, MW1852 might be involved in evading host immune responses, similar to Protein A (SpA) which inhibits opsonophagocytosis and disrupts B-cell function.

  • Expression during infection: Transcriptomic studies could reveal if MW1852 is upregulated during specific infection stages or in response to host factors.

Understanding MW1852's role in pathogenesis would be valuable for developing new therapeutic strategies against S. aureus, which causes numerous serious infections including pneumonia, septicemia, and meningitis .

What approaches can be used to investigate MW1852's potential as a vaccine candidate?

To evaluate MW1852 as a potential vaccine candidate against S. aureus infections, researchers should implement a systematic investigation approach:

  • Conservation analysis:

    • Sequence conservation across clinical isolates (>95% identity would be ideal)

    • Epitope mapping to identify conserved, surface-exposed regions

  • Immunogenicity studies:

    • Analyze MHC binding predictions for T-cell epitopes

    • Test antibody responses in animal models

    • Evaluate both humoral and cellular immune responses

  • Protective efficacy assessment:

    • Challenge studies in appropriate animal models

    • Measurement of bacterial burden reduction

    • Survival rate improvements

    • Opsonophagocytic activity of antibodies

  • Adjuvant optimization:

    • Test various adjuvant formulations to enhance immunogenicity

    • Evaluate different delivery systems (soluble protein, liposomes, virus-like particles)

Given the historical challenges with S. aureus vaccine development (failed clinical trials with other antigens like IsdB and CP5/CP8), researchers should consider combining MW1852 with other conserved antigens for a multi-component vaccine approach rather than relying on a single antigen .

How does MW1852 compare structurally and functionally to other characterized membrane proteins in S. aureus?

Comparing MW1852 to well-characterized S. aureus membrane proteins reveals interesting structural and functional relationships:

ProteinFunctionStructural FeaturesSimilarity to MW1852
Protein A (SpA)Fc/Fab binding, immune evasionSurface-exposed, secretedLimited sequence similarity, different domain architecture
FnBPFibronectin binding, adhesionLPXTG-anchored surface proteinDifferent domain organization
EssBType VII secretionMulti-transmembrane proteinSimilar membrane topology prediction
MW1853UnknownUPF0316 familyHighest sequence similarity, likely related function

While MW1852 appears structurally distinct from major virulence factors like SpA, its conserved nature suggests important functional roles. The protein may be part of an operon or genomic cluster with related functions in cellular physiology or pathogenesis. Further structural studies using techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) or cryo-electron microscopy could reveal functional domains and interaction interfaces .

What are the key considerations for designing antibodies against MW1852?

Developing specific antibodies against MW1852 requires careful antigen design and validation strategies:

  • Antigen selection:

    • Full-length protein may present challenges due to membrane domains

    • Consider hydrophilic, surface-exposed epitopes (10-20 amino acids)

    • Synthesize multiple peptides from different regions

    • Use recombinant soluble domains if transmembrane regions can be excluded

  • Antibody production strategy:

    • Polyclonal sera for initial characterization

    • Monoclonal antibodies for specific epitopes

    • Consider rabbit antibodies for higher affinity

    • Validate with both Western blot and immunofluorescence

  • Cross-reactivity testing:

    • Test against related proteins in S. aureus

    • Validate specificity using MW1852 knockout strains

    • Perform pre-absorption controls

  • Application-specific optimization:

    • For microscopy: Test fixation methods (paraformaldehyde vs. methanol)

    • For flow cytometry: Optimize permeabilization conditions

    • For immunoprecipitation: Test various detergent conditions

Developing reliable antibodies is crucial for studying MW1852 localization, expression patterns during infection, and potential interactions with host or bacterial factors .

What protein-protein interaction methods are most suitable for identifying MW1852 binding partners?

Given the membrane-associated nature of MW1852, specialized approaches for identifying protein-protein interactions are recommended:

  • Membrane-specific methods:

    • Split-ubiquitin yeast two-hybrid system (designed for membrane proteins)

    • Membrane bacterial two-hybrid (BACTH) system

    • Proximity-dependent biotin identification (BioID) with MW1852 as bait

  • Affinity-based approaches:

    • Pull-down assays using His-tagged MW1852 with gentle detergent solubilization

    • Co-immunoprecipitation with anti-MW1852 antibodies

    • Tandem affinity purification (TAP) with dual-tagged constructs

  • Cross-linking strategies:

    • Chemical cross-linking coupled with mass spectrometry (XL-MS)

    • Photo-activatable amino acid incorporation at specific positions

    • In vivo cross-linking in S. aureus

  • Comparative proteomic analysis:

    • Compare membrane proteome of wild-type vs. MW1852-deleted strains

    • Analyze co-regulation patterns in transcriptomic datasets

    • Construct protein-protein interaction networks

These methods should be used in combination, as each has strengths and limitations. Validation of potential interactions requires multiple orthogonal approaches to confirm biological relevance .

How can researchers analyze MW1852 localization and dynamics in living S. aureus cells?

Studying MW1852 localization and dynamics in live bacterial cells requires specialized techniques for bacterial imaging:

  • Fluorescent protein fusions:

    • Consider monomeric fluorescent proteins optimized for bacteria (mScarlet, mNeonGreen)

    • Create both N- and C-terminal fusions to determine optimal configuration

    • Validate functionality of fusion proteins

    • Use inducible promoters to control expression levels

  • Super-resolution microscopy approaches:

    • Structured illumination microscopy (SIM) for improved resolution (~120 nm)

    • Stochastic optical reconstruction microscopy (STORM) for nanoscale resolution

    • Photoactivated localization microscopy (PALM) for single-molecule tracking

  • Dynamic studies:

    • Fluorescence recovery after photobleaching (FRAP) to measure mobility

    • Single-particle tracking to analyze diffusion properties

    • Time-lapse imaging during different growth phases

  • Correlative techniques:

    • Correlative light and electron microscopy (CLEM)

    • Cryo-electron tomography with fluorescent markers

    • Expansion microscopy for improved resolution

These approaches require careful controls to ensure that tagging doesn't disrupt protein function or localization. Comparing results across multiple methods provides more robust insights into MW1852's subcellular distribution and potential functional microdomains .

How might structural biology approaches advance understanding of MW1852 function?

Structural biology techniques offer powerful approaches to elucidate MW1852's function:

  • Crystallography challenges and solutions:

    • Membrane protein crystallization typically requires detergent screening

    • Lipidic cubic phase (LCP) crystallization may improve success rates

    • Consider creating fusion proteins with crystallization chaperones

    • Focus on soluble domains if full-length crystallization proves challenging

  • Cryo-electron microscopy potential:

    • Single-particle analysis for high-resolution structure

    • Use of amphipols or nanodiscs to maintain native-like environment

    • Subtomogram averaging if MW1852 forms regular arrays in membranes

  • NMR approaches:

    • Solution NMR for soluble domains

    • Solid-state NMR for membrane-embedded regions

    • Selective isotopic labeling strategies

  • Integrative structural biology:

    • Combine low-resolution techniques (SAXS, SANS) with computational modeling

    • Use crosslinking-mass spectrometry to provide distance constraints

    • Incorporate evolutionary covariance analysis for contact prediction

A high-resolution structure would significantly advance functional hypotheses by revealing potential binding sites, conformational dynamics, and evolutionary relationships to proteins of known function .

What genomic approaches can reveal about MW1852's role in S. aureus biology?

Genomic and transcriptomic approaches provide valuable insights into MW1852's biological context:

  • Comparative genomics:

    • Analyze conservation across bacterial species

    • Identify synteny (conservation of gene order) in related species

    • Examine genetic linkage to genes of known function

  • Transcriptomic profiling:

    • RNA-seq during different growth phases

    • Differential expression during infection models

    • Response to antibiotic stress or immune factors

  • Functional genomics:

    • CRISPR interference (CRISPRi) for gene knockdown

    • Transposon mutagenesis screens to identify genetic interactions

    • Fitness contribution in different environmental conditions

  • Regulatory network analysis:

    • ChIP-seq to identify transcription factors regulating MW1852

    • Promoter analysis and reporter assays

    • Small RNA regulation potential

These approaches can place MW1852 in broader biological pathways and reveal conditions where its function is particularly important, guiding hypothesis-driven mechanistic studies .

How might MW1852 contribute to novel therapeutic approaches against S. aureus infections?

Exploiting MW1852 for therapeutic development could follow several strategic paths:

  • Target-based drug discovery:

    • Virtual screening against predicted binding pockets

    • Fragment-based approaches if structural data becomes available

    • Peptide inhibitors designed to disrupt specific interactions

  • Immunotherapeutic potential:

    • Monoclonal antibodies if surface-exposed epitopes are identified

    • Antibody-antibiotic conjugates for targeted delivery

    • T-cell based approaches if immunodominant epitopes are found

  • Diagnostic applications:

    • Biomarker potential if expressed during specific infection stages

    • Point-of-care testing development

    • Strain typing if sequence variation exists between lineages

  • Combination approaches:

    • Synergy with conventional antibiotics

    • Multi-target strategies to reduce resistance development

    • Host-directed therapies that capitalize on MW1852-host interactions

With the rise of antimicrobial resistance in S. aureus, particularly MRSA strains, novel therapeutic targets like MW1852 warrant thorough investigation despite the inherent challenges in developing drugs against bacterial membrane proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.