Recombinant Staphylococcus aureus UPF0316 protein SA1727 (SA1727)

Shipped with Ice Packs
In Stock

Description

Definition and Production Overview

SA1727 is a full-length recombinant protein corresponding to the UPF0316 gene product in S. aureus. It is fused to an N-terminal His tag to facilitate purification and functional studies. Key characteristics include:

ParameterDetails
GeneSA1727 (UPF0316)
UniProt IDP61544
Expression HostE. coli
TagN-terminal His tag
Protein LengthFull-length (1–200 amino acids)
FormLyophilized powder
Purity>90% (SDS-PAGE validated)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); add 5–50% glycerol for stability

Source:

Vaccine Development

Recombinant S. aureus proteins (e.g., SaEsxA, SaEsxB) are explored as vaccine antigens due to their immunogenicity and ability to induce Th1/Th17 responses . SA1727’s His-tagged form could similarly be tested for immune modulation.

Antibody Production

The His tag allows affinity purification of SA1727, enabling the generation of specific monoclonal/polyclonal antibodies for serological assays or neutralization studies .

Research Challenges and Gaps

  • Functional Studies: No peer-reviewed studies exist on SA1727’s role in S. aureus pathogenesis, metabolism, or stress response.

  • Antigenicity: Unlike ESAT-6-like proteins (SaEsxA/B) , SA1727’s immunogenic potential remains unexplored.

  • Therapeutic Targets: Unlike GpsB , SA1727 lacks documented essentiality in bacterial survival, limiting its current therapeutic relevance.

Comparative Analysis with Related Proteins

ProteinFunctionTagKey Application
SA1727UnknownHisResearch reagents, antibody production
SaEsxA/SaEsxBTh1/Th17 immunity inductionNativeVaccine development
GpsBCell division regulationNoneTherapeutic target
SdrDImmune evasionNonePathogenesis studies

Observation: SA1727’s His tag differentiates it from native proteins like GpsB or SdrD, which are studied for pathogenic roles.

Future Directions

  1. Functional Elucidation:

    • Bioinformatics analysis (e.g., BLAST, domain prediction) to infer homologs.

    • Knockout studies in S. aureus to assess phenotypic effects.

  2. Vaccine Potential:

    • Evaluate SA1727’s ability to induce protective immunity in murine models.

  3. Diagnostic Tools:

    • Develop ELISA kits (as in ) for detecting anti-SA1727 antibodies in patient sera.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SA1727; UPF0316 protein SA1727
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Staphylococcus aureus (strain N315)
Target Names
SA1727
Target Protein Sequence
MSFVTENPWLMVLTIFIINVCYVTFLTMRTILTLKGYRYIAASVSFLEVLVYIVGLGLVM SNLDHIQNIIAYAFGFSIGIIVGMKIEEKLALGYTVVNVTSAEYELDLPNELRNLGYGVT HYAAFGRDGSRMVMQILTPRKYERKLMDTIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRK LKDYEPEELESVVEHEIQSK
Uniprot No.

Target Background

Database Links

KEGG: sau:SA1727

Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is recombinant SA1727 typically produced for research applications?

Recombinant Staphylococcus aureus UPF0316 protein SA1727 is typically expressed in E. coli expression systems. The protein is commonly produced with an N-terminal His-tag to facilitate purification through affinity chromatography . The general production process involves:

  • Cloning the SA1727 gene (encoding amino acids 1-200) into an appropriate expression vector

  • Transforming the construct into E. coli cells

  • Inducing protein expression under optimized conditions

  • Cell lysis and protein extraction

  • Purification using His-tag affinity chromatography

  • Further purification steps as needed (size exclusion, ion exchange)

  • Lyophilization of the purified protein in a suitable buffer, often containing stabilizers like trehalose

For optimal storage stability, the recombinant protein is typically stored in Tris/PBS-based buffer at pH 8.0 with 6-50% trehalose or glycerol .

What are the recommended experimental conditions for working with recombinant SA1727?

When working with recombinant SA1727 protein, researchers should consider the following recommended experimental conditions:

  • Reconstitution: Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Storage buffer: Optimal storage is in Tris/PBS-based buffer, pH 8.0, with 6-50% trehalose or glycerol

  • Storage conditions: Store at -20°C/-80°C, with working aliquots at 4°C for up to one week

  • Stability considerations: Avoid repeated freeze-thaw cycles as this may compromise protein integrity

  • Working concentration: Concentration should be empirically determined based on the specific experimental setup, but typically ranges from 0.1-10 μg/mL for immunological studies

For experiments studying protein-protein interactions or structural analyses, additional considerations include maintaining proper ionic strength and pH conditions that mimic the protein's native environment .

How can SA1727 be included in experimental designs for Staphylococcus aureus biofilm studies?

When incorporating SA1727 into biofilm experimental designs, researchers should consider methodologies similar to those used in other S. aureus biofilm studies. Based on established protocols for S. aureus biofilm research , the following experimental approach is recommended:

  • Surface preparation: Use appropriate surfaces such as 4-chambered glass bottom petri dishes or similar biofilm-compatible surfaces

  • Bacterial attachment:

    • Apply diluted bacterial suspension (10 μL) containing S. aureus expressing the protein of interest

    • Incubate at 37°C for 30 minutes to allow attachment

    • Gently rinse unattached bacteria with PBS

  • Time-course imaging:

    • For studying SA1727's role, collect image stacks (12-20 μm in size with 1-μm z-slices) at appropriate intervals

    • Use confocal laser scanning microscopy with appropriate fluorescent tags

    • Maintain physiological conditions (5% CO₂, 20% O₂, 50% humidity, 37°C) during imaging

  • Data analysis:

    • Quantify changes in bacterial biomass by measuring thresholded areas of fluorescence

    • Calculate log reductions when studying treatments affecting SA1727-expressing bacteria

For experimental validity, include multiple fields of view (minimum 2 FOVs per condition) and conduct at least 3 independent experiments, as statistical analysis of biofilm studies indicates this provides adequate power to detect significant effects .

What is the putative function of SA1727 in Staphylococcus aureus biology?

The exact function of SA1727 in Staphylococcus aureus biology remains incompletely characterized, but several lines of evidence suggest potential roles:

  • Membrane association: The amino acid sequence analysis indicates transmembrane domains, suggesting SA1727 may function as a membrane protein, potentially involved in transport or signaling processes

  • Conservation: SA1727 belongs to the UPF0316 family and is conserved across multiple S. aureus strains (including N315, MW2, NCTC8325-4, and USA300), indicating functional importance

  • Genomic context: Analysis of the genomic region surrounding SA1727 suggests potential involvement in cellular processes related to membrane integrity or stress response

  • Homology: While not directly documented in the search results, proteins in the UPF (Uncharacterized Protein Family) categories often play roles in basic cellular functions that become apparent under specific stress conditions, similar to other S. aureus proteins that respond to environmental challenges like pH shock

It should be noted that UPF0316 proteins have not been as extensively characterized as other S. aureus virulence factors or surface proteins, suggesting opportunities for novel research into their functional roles.

Does SA1727 play a role in Staphylococcus aureus virulence or pathogenesis?

  • Conservation across strains: SA1727 and its homologs (MW1852, NWMN_1849, SAOUHSC_02131, etc.) are conserved across multiple clinical S. aureus isolates , suggesting functional importance

  • Membrane localization: As a potential membrane protein, SA1727 could contribute to bacterial adaptation to host environments, similar to other membrane proteins that help S. aureus respond to environmental stresses

  • Context of other UPF proteins: While SA1727 itself hasn't been specifically identified as a virulence factor, some previously uncharacterized proteins in S. aureus have later been found to contribute to pathogenesis

For experimental validation of SA1727's role in virulence, researchers could consider:

  • Gene knockout studies comparing wild-type and SA1727-deficient strains in infection models

  • Assessment of SA1727 expression levels during different stages of infection

  • Evaluation of immune responses to SA1727 in infected hosts

How does SA1727 compare to known S. aureus vaccine candidates in immunogenicity studies?

While SA1727 has not been specifically documented as a vaccine candidate in the search results, its potential can be evaluated against established S. aureus vaccine antigen criteria:

Comparison with Known Vaccine Candidates:

CharacteristicSA1727IsdA/IsdBSdrD/SdrEClfA
Surface accessibilityPotential membrane proteinSurface-exposedSurface-exposedSurface-exposed
Conservation across strainsConserved in multiple strainsHighly conservedHighly conservedHighly conserved
ImmunogenicityNot well documentedHigh (IgG titers 45,900±9,156 for IsdA; 36,300±2,741 for IsdB)High (IgG titers 30,000±12,920 for SdrD; 29,000±6,878 for SdrE)High (IgG titers 64,800±9,920)
Protective immunityNot documentedStrong (4.344 log₁₀ reduction for IsdA; 3.468 log₁₀ reduction for IsdB)Strong (3.385 log₁₀ reduction for SdrD; 4.297 log₁₀ reduction for SdrE)Strong (3.341 log₁₀ reduction)
Role in pathogenesisUnclearIron acquisition, adhesionPresumed adhesionAdhesion

Successful S. aureus vaccine candidates like IsdA, IsdB, SdrD, and SdrE generate high antibody titers and demonstrate protective immunity in animal models by reducing bacterial load . Future research on SA1727 would need to evaluate its surface accessibility, ability to induce opsonophagocytic antibodies, and protection in infection models to determine its potential as a vaccine antigen.

What methodologies should be employed to study potential interactions between SA1727 and host immune components?

To investigate potential interactions between SA1727 and host immune components, researchers should consider a multi-faceted approach:

  • In silico analyses:

    • Protein structure prediction and epitope mapping

    • Molecular docking simulations with known immune receptors (TLRs, NLRs)

    • Comparative analysis with known immunogenic S. aureus proteins

  • Binding studies:

    • Direct binding assays using techniques like microscale thermophoresis (as used for IsdB-TLR4 interaction studies )

    • Surface plasmon resonance to determine binding kinetics

    • Co-immunoprecipitation studies with potential immune receptors

  • Cellular response assessment:

    • Stimulation of human monocytes and PMNs with recombinant SA1727

    • Measurement of cytokine production (IL-6, IL-1β) via ELISA

    • Flow cytometry to detect cell activation markers

    • Scanning electron microscopy to observe morphological changes (similar to IsdB studies )

  • Signaling pathway determination:

    • Inhibitor studies targeting key immune signaling pathways (TLR-MyD88, NLRP3 inflammasome)

    • Western blot analysis for phosphorylated signaling proteins

    • Reporter cell lines to detect NF-κB activation or inflammasome assembly

  • In vivo validation:

    • Mouse models with specific immune deficiencies

    • Assessment of SA1727 immunization on subsequent challenge with live S. aureus

    • Histopathological examination of infected tissues

This methodological approach follows established frameworks used to characterize other S. aureus immunomodulatory proteins like IsdB, which was found to interact with TLR4 and activate the NLRP3 inflammasome .

How can researchers effectively compare SA1727 with its homologs across different Staphylococcus aureus strains?

Researchers investigating SA1727 across S. aureus strains should employ a systematic comparative approach:

  • Sequence alignment and phylogenetic analysis:

    • Perform multiple sequence alignment of SA1727 homologs (MW1852, NWMN_1849, SAOUHSC_02131, SAR2004, etc.)

    • Generate phylogenetic trees to visualize evolutionary relationships

    • Identify conserved domains and strain-specific variations

  • Structural comparison:

    • Predict and compare tertiary structures of different homologs

    • Map strain-specific amino acid differences onto structural models

    • Analyze potential functional implications of structural variations

  • Expression analysis:

    • Compare expression levels across strains under standardized conditions

    • Evaluate expression changes in response to environmental stressors

    • Use RT-qPCR and/or RNA-seq to quantify expression differences

  • Functional characterization:

    • Generate recombinant proteins from multiple strain variants

    • Compare biochemical properties (stability, binding affinities)

    • Assess strain-specific differences in immune recognition

  • Genomic context analysis:

    • Examine synteny of genetic regions surrounding SA1727 homologs

    • Identify potential co-regulated genes that differ between strains

    • Analyze regulatory elements that might influence expression

This comprehensive approach allows researchers to determine whether functional differences exist between SA1727 variants that might contribute to strain-specific phenotypes or virulence characteristics.

What are the current methodological challenges in studying membrane-associated proteins like SA1727?

Studying membrane-associated proteins like SA1727 presents several methodological challenges:

  • Protein expression and purification:

    • Membrane proteins often express poorly in heterologous systems

    • Maintaining proper folding during purification is difficult

    • Solution: Use specialized expression systems (membrane protein-optimized E. coli strains) and detergent screening for optimal solubilization

  • Structural determination:

    • Traditional crystallography is challenging for membrane proteins

    • Protein flexibility can complicate structural studies

    • Solution: Consider cryo-EM or NMR approaches, potentially with nanodiscs to mimic membrane environment

  • Functional assays:

    • Functional reconstitution in artificial membranes is technically challenging

    • Assessing true in vivo function requires appropriate models

    • Solution: Develop liposome-based assays and combine with genetic approaches (knockouts, complementation)

  • Interaction studies:

    • Membrane environment affects protein-protein interactions

    • Non-specific binding to detergents can generate artifacts

    • Solution: Utilize membrane mimetics (nanodiscs, liposomes) for interaction studies

  • In vivo localization:

    • Confirming actual membrane localization in S. aureus cells

    • Distinguishing between inner and outer membrane association

    • Solution: Apply fluorescence microscopy with protein fusions or immunogold electron microscopy

Researchers investigating SA1727 should consider adapting methodologies successfully used for other S. aureus membrane proteins, while acknowledging these technical limitations when interpreting experimental results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.