Recombinant Staphylococcus aureus UPF0316 protein SAB1848c (SAB1848c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if needed. We will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on shipping method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize fulfilling your request.
Synonyms
SAB1848c; UPF0316 protein SAB1848c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Staphylococcus aureus (strain bovine RF122 / ET3-1)
Target Names
SAB1848c
Target Protein Sequence
MSFVTENPWLMVLTIFIINVCYVTFLTMRTILTLKGYRYIAASVSFLEVLVYIVGLGLVM SNLDHIQNIITYAFGFSIGIIVGMKIEEKLALGYTVVNVTSAEYELDLPNELRNLGYGVT HYAAFGKDGSRMVMQILTPRKYERKLMDTIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRK LKDYEPEELESVVEHEIQSK
Uniprot No.

Target Background

Database Links

KEGG: sab:SAB1848c

Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant SAB1848c?

Recombinant SAB1848c can be successfully expressed in multiple systems including:

  • Cell-free expression systems

  • E. coli

  • Yeast

  • Baculovirus-infected insect cells

  • Mammalian cell expression systems

Each system offers distinct advantages depending on research requirements. Cell-free expression systems provide rapid production but may yield lower amounts, while E. coli typically offers high yields but might lack appropriate post-translational modifications. The selection of an expression system should be guided by the intended downstream applications and required protein characteristics .

Protein purity of ≥85% can be achieved using standard purification methods as determined by SDS-PAGE analysis .

How should I design between-subjects versus within-subjects experiments when evaluating SAB1848c function?

When investigating SAB1848c function, the experimental design choice depends on your research questions and available resources:

Between-subjects design: Each experimental unit (cell line, animal model, etc.) is exposed to only one condition. This approach is preferred when:

  • Testing for potential irreversible effects of the protein

  • Concerns about carryover effects exist

  • Substantial resources are available for larger sample sizes

This design requires careful random assignment of subjects to different treatment groups to ensure baseline equivalence across conditions .

Within-subjects design: Each experimental unit receives all treatment conditions in sequence. This approach is advantageous when:

  • Investigating comparative effects of wild-type versus mutated SAB1848c

  • Resources limit sample size

  • Individual variability is high

To implement this design with SAB1848c, counterbalancing the order of treatments is crucial to control for potential carryover effects, and appropriate washout periods must be incorporated .

What control conditions should be included when studying the effects of recombinant SAB1848c in experimental systems?

A robust experimental design studying SAB1848c effects should include multiple control conditions:

  • Negative controls:

    • Buffer-only treatment (vehicle control)

    • Irrelevant protein of similar size/structure

    • Heat-denatured SAB1848c (to control for non-specific effects)

  • Positive controls:

    • Known S. aureus virulence factors when testing pathogenesis pathways

    • Established immune stimulants when assessing immune responses

  • Dosage controls:

    • Concentration gradients to establish dose-response relationships

    • Time-course experiments to determine temporal effects

  • Genetic controls:

    • SAB1848c knockout strains

    • Complemented knockout strains to verify specificity

The selection and implementation of these controls should be documented in a standardized protocol to ensure experimental reproducibility .

What is the optimal approach for designing data tables when analyzing SAB1848c experimental results?

When designing data tables for SAB1848c experiments, follow these principles:

  • Structure the table with clear organization:

    • Place the independent variable (e.g., SAB1848c concentration) in the left column

    • Include dependent variables (measured outcomes) in subsequent columns

    • Add columns for multiple trials to demonstrate reproducibility

    • Include a derived quantity column (e.g., means or ratios) on the far right

  • Provide clear titles and labels:

    • Title should state the purpose of the experiment

    • Label all variables with appropriate units

    • Use consistent formatting for values

Example data table format:

Title: Effects of Recombinant SAB1848c Concentration on S. aureus Virulence Factor Expression

SAB1848c Concentration (μg/mL)Virulence Factor Expression (fold change)Mean Expression
Trial 1Trial 2Trial 3(fold change)
0 (control)1.001.001.001.00
51.241.181.321.25
101.561.621.481.55
201.871.931.791.86

This structured approach ensures data clarity and facilitates subsequent statistical analysis .

How should I analyze potential contradictions in SAB1848c functional data across different experimental systems?

When facing contradictory results across different experimental systems:

  • Systematic evaluation approach:

    • Document all experimental conditions precisely (cell types, media composition, incubation times)

    • Identify potential confounding variables (contamination, protein degradation, batch effects)

    • Verify protein activity using standardized assays before each experiment

  • Cross-validation strategies:

    • Employ multiple methodological approaches to test the same hypothesis

    • Use both in vitro and in vivo systems when feasible

    • Collaborate with other laboratories to independently verify findings

  • Statistical reconciliation:

    • Perform meta-analysis of all available data

    • Use statistical methods that account for inter-study variability

    • Consider Bayesian approaches to incorporate prior knowledge

  • Reporting framework:

    • Transparently document all contradictions

    • Propose testable hypotheses that might explain discrepancies

    • Acknowledge limitations of each experimental system

Remember that contradictions often lead to new discoveries about context-dependent protein functions or reveal previously unknown regulatory mechanisms .

How does SAB1848c relate to other S. aureus antigens in vaccine development research?

While SAB1848c is not currently among the primary antigens in S. aureus vaccine development, understanding its relationship to established vaccine candidates provides important context:

  • Current leading S. aureus vaccine antigens:

    • α-hemolysin (Hla)

    • Staphylococcal enterotoxin B (SEB)

    • Staphylococcal protein A (SpA)

    • Iron surface determinant B N2 domain (IsdB-N2)

    • Manganese transport protein C (MntC)

  • Potential complementary role of SAB1848c:

    • As a conserved protein, SAB1848c could potentially complement existing vaccine formulations

    • Investigation of any structural or functional similarities between SAB1848c and established antigens may reveal novel immunogenic epitopes

    • Analyzing cross-reactivity of anti-SAB1848c antibodies with other S. aureus proteins could identify shared epitopes

  • Considerations for incorporation in multi-component vaccines:

    • Recombinant five-antigen S. aureus vaccines (rFSAV) have shown promising results in animal models

    • Addition of novel antigens like SAB1848c would require evaluation of immune response enhancement without interference with existing components

    • Bioconjugation techniques that link polysaccharide and protein antigens represent a promising approach for next-generation vaccines that could potentially incorporate SAB1848c

What methodological approaches should be used to determine if SAB1848c plays a role in S. aureus virulence or immune evasion?

To investigate SAB1848c's potential role in virulence or immune evasion, employ a multi-faceted approach:

  • Genetic manipulation studies:

    • Generate SAB1848c knockout mutants

    • Create complemented strains expressing wild-type or modified SAB1848c

    • Develop strains with controlled SAB1848c overexpression

  • Phenotypic characterization:

    • Compare growth kinetics between wild-type and mutant strains

    • Assess biofilm formation capabilities

    • Evaluate resistance to host defense mechanisms (complement, antimicrobial peptides)

    • Examine persistence in various infection models

  • Host interaction studies:

    • Analyze interactions with host immune cells (neutrophils, macrophages)

    • Measure cytokine/chemokine responses to purified protein

    • Assess binding to host matrix proteins

    • Evaluate impact on immune signaling pathways

  • In vivo infection models:

    • Compare virulence of wild-type versus knockout strains in multiple animal models

    • Assess bacterial burden, dissemination, and host survival

    • Examine histopathological changes in infected tissues

    • Evaluate protective efficacy of anti-SAB1848c antibodies

  • Structural and functional analysis:

    • Determine protein structure through crystallography or cryo-EM

    • Identify potential functional domains through in silico analysis

    • Investigate protein-protein interactions with host and bacterial factors

    • Examine potential enzymatic activities 15

What qualitative and quantitative research approaches are most appropriate for investigating novel functions of SAB1848c?

Investigating novel functions of SAB1848c requires integrating both qualitative and quantitative research approaches:

Quantitative approaches:

  • Experimental research with clearly defined variables and controls

  • High-throughput screening to identify interaction partners

  • Structural biology techniques to determine precise molecular interactions

  • Transcriptomic and proteomic analyses to identify downstream effects

  • Statistical modeling of dose-response relationships

Qualitative approaches:

  • Phenomenological studies to understand the broader context of SAB1848c function

  • Historical analysis of related UPF0316 family proteins

  • Grounded theory development to conceptualize SAB1848c's role in bacterial physiology

  • Case studies of SAB1848c variants in clinical isolates

The most effective research strategy combines these approaches sequentially, with qualitative methods generating hypotheses that can be tested through quantitative experiments. For example, phenomenological observations of SAB1848c's distribution in bacterial cell compartments could inform subsequent quantitative studies on protein localization and trafficking .

How can researchers effectively evaluate contradictory findings regarding SAB1848c function across different S. aureus strains?

When encountering contradictory findings about SAB1848c function across different S. aureus strains:

  • Comprehensive strain characterization:

    • Conduct whole-genome sequencing of all strains used

    • Identify single nucleotide polymorphisms in SAB1848c and potential regulatory elements

    • Analyze differences in genomic context that might affect expression

    • Examine strain-specific differences in post-translational modifications

  • Expression profiling:

    • Compare SAB1848c expression levels across strains under identical conditions

    • Determine if expression timing differs between strains

    • Identify strain-specific co-expressed genes that might affect function

  • Functional validation through strain engineering:

    • Swap SAB1848c alleles between strains to determine if phenotypic differences are protein-specific

    • Create chimeric proteins containing domains from different strain variants

    • Use CRISPR-Cas9 to introduce specific mutations observed in different strains

  • Systematic environmental testing:

    • Evaluate function under diverse environmental conditions (pH, temperature, nutrient availability)

    • Test strain-specific responses to host-derived signals

    • Examine behavior in polymicrobial contexts relevant to natural habitats

  • Data integration framework:

    • Develop computational models incorporating strain-specific variables

    • Use machine learning approaches to identify patterns in complex datasets

    • Create a standardized reporting format to facilitate cross-study comparisons

This methodical approach can transform seemingly contradictory findings into valuable insights about strain-specific adaptations and context-dependent protein functions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.