Recombinant Staphylococcus aureus UPF0316 protein SACOL1973 (SACOL1973)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability.

Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.

Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
SACOL1973; UPF0316 protein SACOL1973
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Staphylococcus aureus (strain COL)
Target Names
SACOL1973
Target Protein Sequence
MSFVTENPWLMVLTIFIINVCYVTFLTMRTILTLKGYRYIAASVSFLEVLVYIVGLGLVM SNLDHIQNIIAYAFGFSIGIIVGMKIEEKLALGYTVVNVTSAEYELDLPNELRNLGYGVT HYAAFGRDGSRMVMQILTPRKYERKLMDTIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRK LKDYEPEELESVVEHEIQSK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How should recombinant SACOL1973 protein be stored to maintain stability?

For optimal stability and activity retention of recombinant SACOL1973, implement the following storage protocol:

Storage DurationTemperatureBuffer ConditionsNotes
Short-term (≤1 week)2-8°C20 mM Tris-HCl, pH 8.0 with 10% glycerolMinimize exposure to freeze-thaw cycles
Long-term storage-20°C to -80°C20 mM Tris-HCl, pH 8.0 with 10% glycerolAliquot before freezing
Working solutions4°CApplication-dependentPrepare fresh weekly

When designing storage protocols, always aliquot the protein before freezing to prevent degradation from repeated freeze-thaw cycles. For membrane-associated proteins like SACOL1973, glycerol serves as a cryoprotectant to maintain protein structure during freezing . Perform stability tests at various time points to establish the optimal storage conditions for your specific research application.

What expression systems are appropriate for producing recombinant SACOL1973?

When selecting an expression system for SACOL1973, consider the protein's membrane-associated nature and potential structural complexity:

Expression SystemAdvantagesLimitationsMethodological Considerations
Escherichia coliHigh yield, cost-effectiveMay misfold membrane proteinsConsider specialized strains (C41/C43) for membrane proteins
Cell-free systemsControl over reaction environmentLower yield, higher costGood for screening optimal conditions
Insect cellsBetter for complex proteinsMore time-consumingConsider for structural studies
Native StaphylococcusAuthentic post-translational modificationsPathogenicity concernsRequires BSL-2 containment

For initial characterization studies, E. coli expression remains the most widely used approach for bacterial recombinant proteins . When expressing in E. coli, optimize codon usage for the host system and consider fusion tags that aid both expression and purification. For membrane proteins like SACOL1973, detergent screening is crucial during purification to maintain native conformation .

How can I design a robust experimental approach to study SACOL1973 function?

Designing rigorous experiments to characterize the unknown function of SACOL1973 requires systematic planning:

  • Define clear research questions based on bioinformatic predictions

  • Determine appropriate variables:

    • Independent variable: SACOL1973 manipulation (expression level, mutations)

    • Dependent variable: Measurable outcomes (growth phenotypes, stress responses)

    • Control variables: Growth conditions, strain background

  • Implement a structured experimental design:

ApproachApplicationDesign Considerations
Gene deletion/complementationIn vivo functionCreate clean deletion and complemented strains
Site-directed mutagenesisStructure-functionTarget conserved residues across homologs
Protein-protein interactionBinding partnersUse multiple methods (pull-down, bacterial two-hybrid)
Localization studiesCellular distributionMembrane fractionation plus microscopy

When designing these experiments, ensure statistical validity through biological replicates (n≥3), appropriate controls, and randomization to minimize bias . For gene function studies, complementation experiments are essential to confirm that observed phenotypes result directly from SACOL1973 manipulation rather than polar effects or secondary mutations.

What controls are essential for experiments involving SACOL1973?

Implementing proper controls is critical for generating reliable data with SACOL1973:

Control TypeExamplesPurposeImplementation Considerations
Negative controlsEmpty vector, inactive mutantAccount for background effectsShould undergo identical processing as test samples
Positive controlsWell-characterized related proteinValidate assay functionalityChoose proteins with established activity in your assay
Expression controlsWestern blot of input samplesVerify protein levelsEssential when comparing wild-type vs. mutant proteins
Specificity controlsUnrelated membrane proteinDistinguish specific from general effectsShould match SACOL1973 in basic properties (size, hydrophobicity)

For genetic studies, the gold standard control approach includes:

  • Clean deletion mutant (ΔSACOL1973)

  • Complemented strain (ΔSACOL1973 + SACOL1973)

  • Vector control (ΔSACOL1973 + empty vector)

This combination allows you to attribute phenotypes specifically to SACOL1973 function while controlling for both the deletion process and the complementation method .

How do I analyze and interpret data from SACOL1973 functional studies?

Analysis of functional data for poorly characterized proteins like SACOL1973 should follow systematic protocols:

  • Data processing workflow:

    • Normalize raw data to appropriate controls

    • Calculate derived parameters (growth rates, binding constants)

    • Apply statistical tests based on data distribution

    • Implement corrections for multiple comparisons

  • Analytical framework:

Data TypeAnalysis ApproachVisualizationStatistical Considerations
Growth phenotypesGrowth rate, lag time, final densityGrowth curves with error barsANOVA for multiple conditions
Protein interactionsBinding affinities, complex stabilityBinding curves, interaction mapsAccount for non-specific binding
Localization dataMembrane/cytoplasmic distributionFractionation blots, microscopy imagesQuantify across multiple cells/replicates
Stress responsesSurvival rates under various conditionsComparative bar graphsConsider both magnitude and kinetics of response
  • Visual analysis protocols:

    • Systematically examine data patterns across conditions

    • Identify outliers and handle consistently

    • Ensure consistent scale and format for comparable data visualizations

When interpreting results, consider multiple hypotheses that could explain observed phenotypes, and design follow-up experiments to distinguish between alternative explanations. For uncharacterized proteins like SACOL1973, integrating data from multiple experimental approaches provides more robust functional insights.

How can structural predictions inform SACOL1973 experimental design?

Leveraging structural predictions can significantly enhance experimental approaches for SACOL1973:

Structural FeaturePrediction MethodExperimental ApplicationMethodological Considerations
Transmembrane domainsTMHMM, PhobiusDesign truncation constructsAvoid disrupting predicted helices
Conserved motifsMultiple sequence alignmentTarget for mutagenesisFocus on residues conserved across species
Protein topologySignalP, TopConsDesign reporters for orientation studiesN/C terminal tagging implications
Structural homologyI-TASSER, AlphaFoldGuide functional hypothesesValidate predictions experimentally

Based on the sequence data, SACOL1973 likely contains multiple transmembrane segments with intervening loops . When designing experiments:

  • For mutagenesis studies, prioritize:

    • Conserved residues in predicted functional domains

    • Charged residues in transmembrane regions (often functionally critical)

    • Residues at interfaces between domains

  • For protein expression:

    • Consider the impact of tags on transmembrane domain insertion

    • Design constructs that preserve predicted structural elements

    • Test multiple construct boundaries for optimal expression and stability

  • For interaction studies:

    • Focus on predicted cytoplasmic or extracellular domains

    • Consider crosslinking approaches for transmembrane interactions

    • Use complementary methods to validate interactions

What purification strategies are most effective for recombinant SACOL1973?

Purifying membrane-associated proteins like SACOL1973 requires specialized approaches:

Purification StageMethod OptionsCritical ConsiderationsTroubleshooting Strategies
Cell lysisSonication, pressure-based methodsAvoid excessive heatingShort pulses, ice bath
Membrane extractionDetergent screeningProtein stability in different detergentsTest panel of mild to strong detergents
Affinity purificationHis-tag, GST, MBPTag position may affect functionTry both N and C-terminal tags
Secondary purificationSize exclusion, ion exchangeBuffer compatibility with detergentsOptimize salt concentration
Quality assessmentSDS-PAGE, mass spectrometryProtein aggregation, degradationMultiple detection methods

A systematic purification workflow should include:

  • Initial detergent screening to identify conditions that extract SACOL1973 while maintaining stability

  • Optimization of solubilization conditions (detergent concentration, salt, pH)

  • Two-step purification combining affinity chromatography with size exclusion

  • Quality control by SDS-PAGE, Western blot, and analytical SEC

For structural studies, consider detergent exchange during purification or reconstitution into nanodiscs or liposomes to better mimic the native membrane environment.

How can I assess the structure-function relationship in SACOL1973?

Investigating structure-function relationships for SACOL1973 requires integrated approaches:

  • Systematic mutagenesis strategy:

Mutation TypeTarget SelectionFunctional AssessmentControls
Alanine scanningConserved residuesCompare to wild-type activityExpression level verification
Domain swappingHomologous proteinsChimeric protein functionDomain integrity confirmation
Deletion constructsPredicted domainsComplementation capacityStability verification
Conservative substitutionsKey residuesPartial vs. complete loss of functionMultiple substitution types
  • Structural characterization methods:

    • Circular dichroism to assess secondary structure content

    • Limited proteolysis to identify domain boundaries

    • Crosslinking studies to map proximity relationships

    • Advanced structural methods (X-ray, cryo-EM) when feasible

  • Experimental workflow:

    • Generate mutations based on sequence conservation and structural predictions

    • Verify mutant protein expression and stability

    • Assess functional consequences using established assays

    • Correlate structural changes with functional outcomes

This systematic approach allows mapping of critical residues and domains to specific functions, even without complete structural information. For transmembrane proteins like SACOL1973, consider both the membrane-spanning regions and the connecting loops, as both can be functionally important.

What approaches can identify potential interaction partners of SACOL1973?

To identify proteins that interact with SACOL1973, implement complementary methods:

MethodAdvantagesLimitationsMethodological Considerations
Bacterial two-hybridIn vivo detectionLimited to binary interactionsTest both N and C-terminal fusions
Co-immunoprecipitationCaptures native complexesRequires specific antibodiesOptimize detergent conditions
Crosslinking mass spectrometryIdentifies transient interactionsComplex data analysisUse membrane-permeable crosslinkers
Proximity labelingWorks in native environmentBackground labeling issuesOptimize labeling time and conditions
Genetic interaction screensFunctional relevanceLabor intensiveFocus on synthetic lethal interactions

Experimental design considerations:

  • Controls are critical:

    • Empty vector/non-relevant protein controls

    • Both positive and negative interaction controls

    • Verification of bait protein expression and localization

  • Validation strategy:

    • Confirm interactions by at least two independent methods

    • Verify biological relevance through genetic studies

    • Map interaction domains through truncation/mutation

  • Data analysis:

    • For high-throughput approaches, implement appropriate statistical filtering

    • Consider the biological context when interpreting potential interactions

    • Prioritize interactions that appear across multiple experimental approaches

Given SACOL1973's predicted membrane localization, methods optimized for membrane protein interactions (such as split-ubiquitin yeast two-hybrid or proximity labeling) may provide better results than traditional approaches.

What safety protocols should be implemented when working with recombinant S. aureus proteins?

When working with recombinant S. aureus proteins like SACOL1973, implement appropriate safety measures:

Risk CategorySafety MeasuresRationaleImplementation Notes
Biological safetyBSL-2 practices for expressionS. aureus is a BSL-2 organismFollow institutional guidelines
Personal protectionGloves, lab coat, eye protectionPrevent direct contactChange gloves after handling
Aerosol controlBiological safety cabinetMinimize inhalation riskFor procedures creating aerosols
Waste managementChemical disinfection, autoclavingComplete decontaminationFollow institutional protocols

Key safety protocol elements:

  • Perform a risk assessment before beginning work

  • Ensure all personnel are trained in appropriate biosafety practices

  • Maintain documentation of safety procedures and training

  • Implement specific protocols for accidental exposure or spills

While purified recombinant proteins generally pose lower risks than intact organisms, maintaining good laboratory practices is essential, particularly when working with proteins from pathogens like S. aureus .

What regulatory considerations apply to research with recombinant S. aureus proteins?

Research involving recombinant S. aureus proteins like SACOL1973 necessitates attention to several regulatory frameworks:

  • Institutional approvals:

    • Institutional Biosafety Committee (IBC) approval for recombinant DNA work

    • Documentation of risk assessment and containment measures

    • Compliance with institutional safety protocols

  • National and international regulations:

Regulatory FrameworkApplicable AspectsCompliance Approach
NIH Guidelines (US)rDNA research classificationRegister with IBC, follow containment guidelines
Import/export controlsMaterial transfer across bordersObtain proper permits before shipping/receiving
Dual-use research assessmentPotential misuse evaluationDocument legitimate research purpose
  • Publication and data sharing:

    • Follow journal guidelines for methods reporting

    • Document biosafety approvals in manuscripts

    • Consider appropriate sharing restrictions for dual-use concerns

The regulatory landscape for recombinant protein research was significantly shaped by the Asilomar Conference on Recombinant DNA, which established foundational principles for responsible biotechnology research that continue to influence current regulations .

How can I address poor expression or solubility of recombinant SACOL1973?

Membrane proteins like SACOL1973 often present expression and solubility challenges:

IssuePotential CausesSolutionsExperimental Approach
Low expressionCodon bias, toxicityCodon optimization, tightly regulated promotersTest multiple expression strains and conditions
Inclusion bodiesRapid expression, misfoldingLower induction temperature, co-express chaperonesOptimize induction parameters
Poor solubilityHydrophobic domainsDetergent screening, fusion partnersSystematic detergent panel testing
DegradationProtease sensitivityProtease inhibitors, expression in protease-deficient strainsTime-course analysis to identify degradation

Systematic troubleshooting protocol:

  • Expression optimization:

    • Test multiple E. coli strains (BL21, C41/C43 for membrane proteins)

    • Vary induction conditions (temperature, IPTG concentration, duration)

    • Consider fusion partners (MBP, SUMO) to enhance solubility

    • Screen expression media compositions

  • Solubilization strategy:

    • Test detergent panel (starting with mild non-ionic detergents)

    • Optimize detergent concentration and buffer conditions

    • Consider addition of stabilizing agents (glycerol, specific lipids)

    • Evaluate alternative solubilization approaches (SMALPs, nanodiscs)

Document all optimization experiments systematically to identify patterns and establish reproducible conditions for SACOL1973 production.

How do I interpret contradictory results in SACOL1973 functional studies?

When faced with contradictory results in functional studies of SACOL1973:

  • Systematic analysis approach:

Source of ContradictionInvestigation MethodResolution StrategyDocumentation Needs
Experimental conditionsCompare protocols in detailStandardize critical parametersRecord all experimental variables
Strain differencesSequence verificationTest in multiple backgroundsDocument strain genotypes
Protein variantsExpression analysisUse identical constructsVerify protein sequence and tags
Technical artifactsImplement different methodsTriangulate with multiple approachesRecord all technical details
  • Resolution framework:

    • Identify specific points of contradiction between results

    • Systematically test hypotheses that could explain differences

    • Design experiments that directly address contradictions

    • Consider whether results are truly contradictory or reflect different aspects of complex function

  • Data integration approach:

    • Implement statistical meta-analysis where appropriate

    • Consider whether contextual factors explain apparent contradictions

    • Develop models that can accommodate seemingly contradictory observations

    • Design critical experiments that can distinguish between alternative models

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.