Recombinant Staphylococcus aureus UPF0316 protein SAHV_1896 (SAHV_1896)

What is the structural characterization of SAHV_1896 and how does it compare to other S. aureus membrane proteins?

SAHV_1896 is a 200-amino-acid recombinant protein (Uniprot ID: A7X441) with predicted structural motifs common to bacterial membrane-associated proteins. The protein's amino acid sequence begins with "MSFVTENPWLMVLTIFIINVCYVTFLTMRTILTLKGYRYIAASVSFLEVLVYIVGLGLVM..." and contains domains suggesting membrane association.

Comparing SAHV_1896 with related S. aureus proteins:

The partial sequence (amino acids 1–200) presents certain limitations for functional studies as it may lack critical domains necessary for complete mechanistic insights.

What are the optimal storage conditions for maintaining SAHV_1896 stability for long-term experimental use?

SAHV_1896 requires specific storage conditions to maintain stability and prevent protein degradation:

For optimal stability, the protein requires strict storage at -80°C with glycerol to prevent aggregation. Repeated freeze-thaw cycles significantly reduce protein activity, so it is recommended to create small working aliquots upon initial thawing .

How should researchers design experiments to evaluate SAHV_1896 immunogenicity in the context of S. aureus vaccine development?

When designing experiments to evaluate SAHV_1896 immunogenicity, researchers should consider the following methodological framework:

• Control selection: Include both positive controls (known immunogenic S. aureus proteins like SpA mutants) and negative controls (buffer only) .

• Experimental groups design:

  • SAHV_1896 alone

  • SAHV_1896 with adjuvant (e.g., AS01)

  • SAHV_1896 conjugated to carrier protein

  • Sham (adjuvant only)

• Immunization protocol: Consider a prime-boost strategy similar to successful S. aureus vaccine candidates with 2-3 week intervals between doses .

• Measurement endpoints:

  • Antibody titers (ELISA)

  • Functional antibody testing (opsonophagocytic killing assays)

  • T-cell responses (cytokine profiles)

  • Challenge protection studies

• Challenge model selection: Skin infection models have shown effectiveness for evaluating S. aureus vaccine candidates, with measurement of dermonecrotic lesions and bacterial burden in tissues .

Researchers should note that previous S. aureus vaccine candidates such as StaphVAX and V710 showed promising immunogenicity but failed in clinical efficacy, possibly due to IL-10 overproduction which inactivates antibodies . Therefore, measuring IL-10 levels in response to SAHV_1896 immunization would be a critical component of experimental design.

What experimental design approaches are most appropriate for evaluating SAHV_1896 interactions with host immune cells?

A robust experimental design for evaluating SAHV_1896 interactions with host immune cells should include:

• Variable identification and control:

  • Independent variable: SAHV_1896 concentration/treatment

  • Dependent variables: Immune cell activation markers, cytokine production, phagocytic activity

  • Control variables: Cell culture conditions, stimulation duration

• Cell types for assessment:

  • Human monocytic cell lines (THP-1)

  • Primary human monocytes/macrophages

  • Dendritic cells

  • B and T lymphocytes

• Assessment of phagocytosis:
  Implement a THP-1 cell-based phagocytosis assay using GFP-labeled S. aureus:

  • Pre-opsonize bacteria with sera containing anti-SAHV_1896 antibodies

  • Incubate with THP-1 cells (bacteria-to-cell ratio of 200:1)

  • Add lysostaphin to eliminate non-internalized bacteria

  • Measure GFP-positive THP-1 cells by flow cytometry

• Cytokine analysis:

  • Measure key cytokines (IL-10, IL-2, IL-17) that have been implicated in S. aureus vaccine responses

  • Compare cytokine profiles between SAHV_1896-stimulated and control groups

• Controls:

  • Positive control: SpA (Staphylococcal protein A) - known immunomodulator

  • Negative control: Buffer only

  • Comparative control: Wood strain S. aureus without protein A

This experimental approach enables assessment of both direct cellular interactions and potential immunomodulatory effects of SAHV_1896, similar to those documented with other S. aureus proteins .

What approaches should be used to evaluate whether SAHV_1896 contributes to S. aureus immune evasion mechanisms?

Evaluating SAHV_1896's potential role in immune evasion requires a multi-faceted approach:

• Comparative analysis with known immune evasion proteins:
  Assess SAHV_1896 alongside SpA, which is known to induce regulatory T cells (Tregs) and suppress immune responses . Measure:

  • Treg induction (CD4+CD25+CD127dim) by flow cytometry

  • IL-10 production, which has been implicated in S. aureus vaccine failures

  • Antibody-neutralizing activity

• Co-culture experiments:

  • Establish monocyte-derived dendritic cell (MoDC)/T cell co-cultures

  • Stimulate with purified SAHV_1896 vs. whole S. aureus

  • Measure T cell activation markers and regulatory T cell induction

  • Collect supernatants to test for immunosuppressive activity

• Animal model studies:
  Design experiments similar to those used for SpA evaluation:

  • Vaccinate mice with SAHV_1896 or control

  • Challenge with S. aureus infection

  • Assess bacterial burden, dissemination, and immune responses

  • Measure protection against recurrent infection

• Gene knockout studies:

  • Compare virulence and immune evasion between wild-type S. aureus and SAHV_1896 knockout strains

  • Assess bacterial persistence in phagocytes and tissues

  • Analyze antibody responses to infection with each strain

This methodological framework would allow researchers to determine if SAHV_1896, like other S. aureus proteins such as SpA, contributes to immune evasion through mechanisms such as inducing regulatory T cells or modulating IL-10 production .

How can researchers design experiments to assess whether SAHV_1896 could serve as a component in multi-antigen S. aureus vaccine formulations?

Designing experiments to evaluate SAHV_1896 as a potential vaccine component requires systematic assessment of its contribution to protective immunity:

• Adjuvant selection and optimization:

  • Test SAHV_1896 with different adjuvants (e.g., AS01, alum)

  • Measure antibody titers and functional activity

  • Assess T cell responses (Th1/Th17/Th2 balance)

• Combinatorial vaccine design:
  Create multi-antigen formulations based on successful approaches in S. aureus vaccine development:

  • SAHV_1896 + capsular polysaccharides (CP5/CP8)

  • SAHV_1896 + α-toxin (Hla)

  • SAHV_1896 + SpA mutant (SpA KKAA)

  Test these combinations for synergistic immune responses .

• Bioconjugation approach:
  Previous research indicates that bioconjugation (versus chemical conjugation) of S. aureus antigens shows promise:

  • Generate bioconjugates of SAHV_1896 with capsular polysaccharides

  • Compare immunogenicity of bioconjugates vs. chemical conjugates

  • Assess protection in animal models

• Protection studies in animal models:
  Implement challenge models that reflect different clinical manifestations:

  • Skin infection model (measure lesion development)

  • Bacteremia model

  • Pneumonia model

  Measurement endpoints should include:

  • Area under curve (AUC) of dermonecrotic lesions

  • Bacterial burden in tissues (CFU counts)

  • Dissemination severity index

• Immune repertoire expansion:
  Assess whether SAHV_1896 vaccination expands antibody responses to other S. aureus antigens, as observed with SpA vaccination:

  • Use protein microarrays to evaluate antibody responses against multiple S. aureus antigens

  • Compare antibody repertoire between SAHV_1896-vaccinated and control animals

  • Assess functional properties of antibodies (opsonophagocytic activity)

This comprehensive experimental approach would determine whether SAHV_1896 could enhance protective immunity as part of a multi-component vaccine against S. aureus.

What are the critical methodological considerations for expressing and purifying functional SAHV_1896 protein for research applications?

Successful expression and purification of functional SAHV_1896 require attention to several critical parameters:

• Expression system selection:

  • E. coli is the established system for SAHV_1896 expression

  • BL21(DE3) or similar strains optimized for membrane protein expression are recommended

  • Consider codon optimization for the expression host

• Tag selection and placement:

  • His-tag is commonly used for SAHV_1896 purification

  • N-terminal tag placement is preferred to avoid interfering with C-terminal functional domains

  • TEV protease cleavage site can be incorporated for tag removal if required for functional studies

• Expression conditions optimization:

  • Temperature: Lower temperatures (16-25°C) may improve folding of membrane-associated proteins

  • IPTG concentration: 0.1-0.5 mM range, optimized for yield vs. solubility

  • Medium: Consider auto-induction media for higher yields

• Purification strategy:

  • Initial capture: Immobilized metal affinity chromatography (IMAC)

  • Secondary purification: Size exclusion chromatography

  • Buffer composition: Tris-based buffer with 50% glycerol for final storage

  • Target purity: >85% via SDS-PAGE

• Quality control assessments:

  • SDS-PAGE for purity assessment

  • Western blot for identity confirmation

  • Mass spectrometry for precise molecular weight determination

  • Circular dichroism to verify secondary structure integrity

• Troubleshooting common issues:

  • Poor solubility: Add detergents (0.1% Triton X-100 or 0.5% CHAPS)

  • Protein aggregation: Optimize glycerol concentration (30-50%)

  • Low yield: Test different E. coli strains (Rosetta, Arctic Express)

  • Degradation: Add protease inhibitors during purification

By carefully optimizing these parameters, researchers can obtain high-quality SAHV_1896 protein suitable for downstream functional and structural studies.

How should researchers address data inconsistencies when evaluating immune responses to SAHV_1896 in different experimental models?

When faced with data inconsistencies in immune response studies with SAHV_1896, implement the following systematic approach:

• Data validation and quality control:

  • Verify protein quality using SDS-PAGE and mass spectrometry

  • Confirm endotoxin levels are below threshold (<0.1 EU/μg protein)

  • Validate assay performance with appropriate positive and negative controls

• Model-specific considerations:

  • In vitro cell models: Account for donor variability in primary human cells; use minimum 3-5 donors

  • Mouse models: Consider strain differences in S. aureus susceptibility

  • Time course variability: Establish consistent sampling timepoints based on preliminary kinetic studies

• Statistical approach for managing variability:

  • Implement appropriate statistical methods for data with high variability

  • Use non-parametric tests when data does not follow normal distribution

  • Consider mixed-effects models when analyzing data with multiple sources of variation

• Addressing specific inconsistencies:

  Type of Inconsistency	Investigation Approach	Mitigation Strategy
  Variable antibody responses	Check for pre-existing immunity to S. aureus	Stratify analysis based on baseline antibody levels
  Differences between in vitro and in vivo results	Evaluate protein stability in physiological conditions	Measure protein half-life in relevant biological matrices
  Strain-dependent effects	Test with multiple S. aureus clinical isolates	Report results with strain specificity clearly noted
  Adjuvant-dependent outcomes	Compare multiple adjuvant formulations	Standardize on adjuvant with most consistent results

• Experimental design refinements:

  • Increase biological replicates (n≥6 for animal studies)

  • Include additional timepoints when measuring dynamic responses

  • Incorporate internal controls for normalization across experiments

• Cross-validation strategies:

  • Employ multiple complementary assays to measure the same parameter

  • Validate key findings across different experimental models

  • Consider blind assessment of subjective measurements

This systematic approach enables researchers to identify sources of variability, enhance experimental rigor, and develop more consistent and reliable data sets when working with SAHV_1896.

How might SAHV_1896 research integrate with emerging approaches in S. aureus vaccine development?

SAHV_1896 research can strategically align with cutting-edge approaches in S. aureus vaccine development through several methodological pathways:

• Integration with bioconjugate technology:
  Recent advances show that "designer" glycoconjugates containing multiple antigens from S. aureus demonstrate superior immunogenicity compared to traditional approaches . Researchers should:

  • Evaluate SAHV_1896 as a carrier protein for capsular polysaccharides

  • Compare bioconjugation vs. chemical conjugation methods

  • Assess whether SAHV_1896-based conjugates circumvent issues encountered with previous failed vaccines

• Addressing IL-10-mediated immune suppression:
  Recent research identified that S. aureus induces IL-10 production in B cells, rendering antibodies unable to kill the pathogen . Experiments should:

  • Measure IL-10 induction by SAHV_1896

  • Test combination strategies with IL-10 neutralizing agents

  • Evaluate T cell responses (particularly IL-17 and IL-2 production) which correlate with protection

• Combination with SpA-based approaches:
  Studies show that modified SpA vaccines expand antibody repertoire against multiple S. aureus antigens . Researchers could:

  • Test SAHV_1896 in combination with SpA mut (detoxified SpA)

  • Assess whether this combination enhances phagocytosis by specialized human cells

  • Evaluate if the combination expands antibody responses to additional antigens

• Application of advanced experimental design methods:
  Systematic experimental approaches can accelerate vaccine development :

  • Implement factorial experimental designs to efficiently test multiple variables

  • Use within-subjects designs when appropriate to reduce variability

  • Apply adaptive trial designs that modify parameters based on interim analysis

• Incorporation of S. aureus evolution insights:
  Recent studies on experimentally evolved S. aureus show adaptation mechanisms that might inform vaccine design :

  • Evaluate if SAHV_1896 expression changes during host adaptation

  • Assess conservation across clinical isolates with variable virulence

  • Determine if mutations in related pathways (e.g., amino acid transporters) affect protein function

By integrating SAHV_1896 research with these emerging approaches, researchers may develop more effective vaccine strategies that overcome the limitations of previous failed candidates.

What advanced methodological approaches could be employed to determine the functional role of SAHV_1896 in S. aureus pathogenesis?

Determining the functional role of SAHV_1896 in S. aureus pathogenesis requires sophisticated methodological approaches:

• CRISPR-Cas9 genome editing strategies:

  • Generate precise SAHV_1896 knockout strains

  • Create point mutations in specific domains

  • Develop complementation strains expressing wild-type or mutant SAHV_1896

  • Compare virulence properties in multiple infection models

• Interactome analysis:

  • Employ proximity-based labeling methods (BioID, APEX)

  • Perform co-immunoprecipitation followed by mass spectrometry

  • Use yeast two-hybrid screening to identify protein-protein interactions

  • Validate key interactions with co-localization studies

• Advanced infection models:

  • Implement human organoid systems to study host-pathogen interactions

  • Use ex vivo human tissue infection models

  • Develop humanized mouse models expressing relevant human receptors

  • Apply intravital microscopy to visualize bacterial-host interactions in real-time

• Multi-omics integration:

  Approach	Application	Expected Insight
  Transcriptomics	RNA-Seq of S. aureus during infection	Temporal expression patterns of SAHV_1896
  Proteomics	Quantitative analysis of protein abundance	SAHV_1896 levels in different growth conditions
  Metabolomics	Metabolite profiling of mutant vs. wild-type	Metabolic pathways affected by SAHV_1896
  Structural biology	Cryo-EM or X-ray crystallography	SAHV_1896 structure and functional domains

• Host response characterization:

  • Compare innate immune responses to wild-type vs. SAHV_1896 mutants

  • Analyze neutrophil extracellular trap (NET) formation

  • Assess intracellular survival in phagocytes

  • Measure antimicrobial peptide susceptibility

• Experimental evolution approach:
  Building on recent S. aureus evolution studies :

  • Subject SAHV_1896 mutants to serial passage under selective pressure

  • Identify compensatory mutations that arise

  • Determine fitness costs of SAHV_1896 mutation

  • Assess competition between wild-type and mutant strains

These advanced methodological approaches would provide comprehensive insights into SAHV_1896's role in S. aureus pathogenesis and potentially identify new targets for therapeutic intervention.