Recombinant Staphylococcus aureus UPF0316 protein SAOUHSC_02131 (SAOUHSC_02131)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SAOUHSC_02131; UPF0316 protein SAOUHSC_02131
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Staphylococcus aureus (strain NCTC 8325)
Target Names
SAOUHSC_02131
Target Protein Sequence
MSFVTENPWLMVLTIFIINVCYVTFLTMRTILTLKGYRYIAASVSFLEVLVYIVGLGLVM SNLDHIQNIIAYAFGFSIGIIVGMKIEEKLALGYTVVNVTSAEYELDLPNELRNLGYGVT HYAAFGRDGSRMVMQILTPRKYERKLMDTIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRK LKDYEPEELESVVEHEIQSK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for recombinant SAOUHSC_02131?

For optimal stability, recombinant SAOUHSC_02131 should be stored in Tris-based buffer containing 50% glycerol at -20°C for routine storage or -80°C for long-term preservation . Experimental evidence suggests that repeated freeze-thaw cycles significantly reduce protein activity; therefore, preparation of single-use aliquots is highly recommended . Working aliquots can be maintained at 4°C for up to one week without significant degradation.

When handling the protein for experimental procedures, it's advisable to:

  • Thaw samples rapidly at room temperature followed by incubation on ice

  • Include protease inhibitors in working buffers

  • Validate protein stability under experimental conditions using SDS-PAGE

Maintaining proper pH (typically 7.5-8.0) and ionic strength helps preserve the native conformation and activity of membrane proteins like SAOUHSC_02131.

How should researchers validate the identity and purity of recombinant SAOUHSC_02131?

Validating recombinant SAOUHSC_02131 requires a multi-technique approach. Standard validation protocols should include:

  • SDS-PAGE analysis: Expect a band at approximately 20.85 kDa, which corresponds to the predicted molecular weight of SAOUHSC_02131 .

  • Western blotting: Using antibodies against SAOUHSC_02131 or against any fusion tags if present. For membrane proteins, complete solubilization using appropriate detergents (e.g., n-dodecyl β-D-maltoside or SDS) is crucial for accurate molecular weight determination.

  • Mass spectrometry: Tryptic digest followed by peptide mass fingerprinting provides definitive identification.

  • Circular dichroism spectroscopy: To confirm proper secondary structure formation, particularly important for membrane proteins with transmembrane helices.

Researchers should aim for protein purity exceeding 90%, assessed by densitometry of Coomassie-stained gels. Integrity of transmembrane domains can be further evaluated through membrane fractionation studies.

What are the critical considerations for designing experiments involving SAOUHSC_02131?

Designing robust experiments with SAOUHSC_02131 requires careful attention to several critical variables:

  • Protein localization: As SAOUHSC_02131 is membrane-associated, experiments must account for this compartmentalization. Membrane fractionation techniques similar to those described for other S. aureus membrane proteins are recommended .

  • Independent variable selection: Clear definition of experimental variables is essential. For functional studies, consider:

    Independent VariableControl MethodMeasurement Approach
    Protein concentrationSerial dilutionBradford/BCA assay
    Buffer compositionSystematic variationpH/conductivity
    TemperatureControlled incubationContinuous monitoring
    Interacting proteinsPresence/absencePull-down assays
  • Controls: Include both positive controls (known membrane proteins of similar size) and negative controls (cytoplasmic proteins) to validate experimental outcomes .

  • Replication strategy: A minimum of three biological replicates and three technical replicates per condition is recommended to ensure statistical power .

  • Hypothesis formulation: Develop specific, testable hypotheses regarding SAOUHSC_02131 function based on structural predictions and homology to characterized proteins .

Researchers should document all experimental parameters meticulously to ensure reproducibility, following the principles of good experimental design as outlined in contemporary methodology guidelines .

What purification strategies are most effective for recombinant SAOUHSC_02131?

Purifying membrane proteins like SAOUHSC_02131 presents unique challenges requiring specialized approaches:

  • Solubilization: Initial screening of detergents is crucial. Try:

    • Mild detergents: n-dodecyl β-D-maltoside (DDM), digitonin

    • Medium-strength: n-octyl β-D-glucopyranoside (OG)

    • Stronger: sodium dodecyl sulfate (SDS)

  • Affinity chromatography: If expressing with tags (His, GST, etc.), optimize binding and elution conditions specifically for membrane proteins:

    • Include detergent in all buffers

    • Use longer binding times (1-2 hours vs. 30 minutes)

    • Consider gradient elution to improve purity

  • Secondary purification: Size exclusion chromatography in detergent-containing buffers helps remove aggregates and impurities.

  • Detergent exchange: If necessary for downstream applications, detergent can be exchanged using dialysis or desalting columns.

  • Quality control: Assess homogeneity using dynamic light scattering and analytical ultracentrifugation, techniques particularly valuable for membrane proteins.

Each batch should be validated for structural integrity using circular dichroism to ensure that purification processes haven't disrupted the native conformation.

How can researchers optimize expression systems for SAOUHSC_02131?

Optimizing expression of membrane proteins like SAOUHSC_02131 requires systematic evaluation of multiple parameters:

  • Expression host selection:

    • E. coli strains: C41(DE3), C43(DE3), or Lemo21(DE3) specifically engineered for membrane protein expression

    • Yeast systems: Pichia pastoris offers advantages for eukaryotic-like post-translational modifications

    • Cell-free systems: Consider for toxic or difficult-to-express proteins

  • Induction parameters:

    • Lower temperature (16-25°C rather than 37°C)

    • Reduced inducer concentration (0.1-0.5 mM IPTG vs. 1 mM)

    • Extended induction time (overnight vs. 3-4 hours)

  • Fusion partners to consider:

    • Solubility enhancers: MBP, SUMO, or Trx

    • Purification tags: His6, Strep-tag II, or FLAG

    • Specialized membrane protein fusion partners: Mistic or YidC

  • Codon optimization:

    • Adapt codons to match host preference, particularly for rare codons

Expression should be verified through Western blotting of membrane fractions, as whole-cell lysates may underrepresent membrane-integrated proteins. Following the approach used with other S. aureus membrane proteins, ultracentrifugation at 100,000 × g for 45 minutes can effectively separate membrane fractions for analysis .

How might SAOUHSC_02131 interact with the Type VII Secretion System in S. aureus?

The potential interaction between SAOUHSC_02131 and the Type VII Secretion System (T7SS) represents an important area for investigation. Based on current understanding of S. aureus membrane protein interactions with T7SS components:

  • Co-localization studies: Fluorescence microscopy with tagged versions of SAOUHSC_02131 and T7SS components (e.g., EssC) can reveal spatial relationships. These should be designed with:

    • Multiple fluorescent tag options to control for tag interference

    • Live-cell imaging to capture dynamic interactions

    • Super-resolution techniques for detailed co-localization analysis

  • Protein-protein interaction assays:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Co-immunoprecipitation with crosslinking

    • FRET/BRET to detect interactions in living cells

  • Functional dependency tests:

    • Examine SAOUHSC_02131 stability in T7SS mutants (especially ΔessC)

    • Test protein localization patterns in wild-type vs. T7SS mutants

    • Assess membrane extraction profiles with increasing urea concentrations

The thesis by Ulhuq provides a methodological framework for investigating membrane protein interactions with the T7SS, demonstrating that some S. aureus membrane proteins show dependency on EssC for stability . Similar approaches could be applied to SAOUHSC_02131, with membrane fractionation followed by Western blotting to determine if protein stability changes in T7SS mutants.

What advanced structural analysis techniques are most suitable for studying SAOUHSC_02131?

For comprehensive structural characterization of SAOUHSC_02131, researchers should consider a multi-technique approach:

  • X-ray crystallography:

    • Challenges: Obtaining membrane protein crystals requires specialized detergents (e.g., maltosides, glucosides)

    • Solutions: Lipidic cubic phase crystallization, antibody fragment co-crystallization

    • Expected resolution: 2.0-3.5 Å for well-diffracting crystals

  • Cryo-electron microscopy:

    • Particularly valuable for membrane proteins resistant to crystallization

    • Sample preparation in nanodiscs or amphipols often preserves native structure

    • Single-particle analysis can resolve structures at 2.5-4 Å resolution

  • NMR spectroscopy:

    • Solution NMR: Limited to smaller membrane proteins or domains

    • Solid-state NMR: Applicable to membrane-embedded proteins

    • Provides dynamic information not available from static techniques

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps solvent-accessible regions and conformational changes

    • Compatible with detergent-solubilized membrane proteins

    • Provides information on structural dynamics

  • Integrative modeling approaches:

    • Combining low-resolution experimental data with computational models

    • Molecular dynamics simulations in membrane environments

    • Co-evolutionary analysis for structure prediction

Each technique offers complementary information, and researchers should select methods based on specific research questions and available resources. For initial characterization, computational structure prediction using services like RaptorX can provide valuable starting models, similar to the approach used for TspA in S. aureus research .

How can researchers investigate the role of SAOUHSC_02131 in bacterial competition or host interaction?

Investigating SAOUHSC_02131's potential role in bacterial competition or host interaction requires sophisticated experimental designs:

  • Genetic manipulation approaches:

    • Create clean deletion mutants using allelic exchange

    • Complement mutations with controlled expression systems

    • Generate point mutations in predicted functional domains

    • Use CRISPR interference for temporal control of expression

  • Bacterial competition assays:

    • Direct competition between wild-type and mutant strains

    • Mixed culture experiments with tracking markers

    • Transwell systems to identify secreted factors

    • Analyze survival ratios under various stress conditions

  • Host cell interaction studies:

    • Neutrophil interaction assays measuring phagocytosis efficiency

    • Macrophage infection models assessing bacterial survival

    • Complement resistance testing

    • Membrane potential disruption assays

  • In vivo models:

    • Mouse infection models (similar to those used for T7SS studies)

    • Zebrafish (Danio rerio) embryo infection model for real-time visualization

    • Evaluate bacterial loads, dissemination, and host responses

The thesis by Ulhuq provides detailed methodologies for developing appropriate in vivo models to study S. aureus virulence factors, including methods to assess interactions with neutrophils and macrophages, which could be adapted to study SAOUHSC_02131 .

How should researchers approach contradictory results in SAOUHSC_02131 functional studies?

When encountering contradictory results in SAOUHSC_02131 studies, a systematic troubleshooting approach is essential:

  • Methodological validation:

    • Verify protein identity through mass spectrometry

    • Confirm proper membrane localization and orientation

    • Assess protein folding and stability under experimental conditions

    • Validate activity assays with positive and negative controls

  • Experimental variables analysis:

    • Create a comprehensive table documenting all experimental conditions:

    VariableExperiment AExperiment BPotential Impact
    Buffer composition[details][details]Protein stability
    Temperature[details][details]Activity/folding
    Strain background[details][details]Genetic interactions
    Protein concentration[details][details]Aggregation state
  • Statistical rigor review:

    • Evaluate sample sizes for adequate power

    • Reassess statistical methods for appropriateness

    • Consider blinded analysis to minimize bias

    • Implement robust statistical approaches (e.g., bootstrapping)

  • Alternative hypotheses generation:

    • Consider context-dependent protein function

    • Evaluate post-translational modifications

    • Investigate potential binding partners

    • Examine strain-specific effects

  • Independent verification:

    • Employ orthogonal experimental techniques

    • Collaborate with independent laboratories

    • Validate with different protein preparations

When reporting contradictory results, researchers should transparently document all experimental conditions and present multiple working models that could explain the discrepancies, following the principles of good experimental design .

What bioinformatic approaches can help predict SAOUHSC_02131 function?

Comprehensive bioinformatic analysis of SAOUHSC_02131 can provide valuable functional predictions:

  • Sequence-based analysis:

    • PSI-BLAST for distant homology detection

    • Multiple sequence alignment with UPF0316 family proteins

    • Identification of conserved domains and motifs

    • Transmembrane topology prediction (TMHMM, MEMSAT)

  • Structural bioinformatics:

    • Ab initio structure prediction (AlphaFold2, RaptorX)

    • Molecular dynamics simulations in membrane environments

    • Binding site prediction

    • Electrostatic surface analysis

  • Genomic context analysis:

    • Examine neighboring genes for functional clues

    • Assess gene conservation across Staphylococcal species

    • Identify potential operonic structures

    • Compare genomic organization in related bacteria

  • Protein-protein interaction prediction:

    • Text mining of literature for interaction partners

    • Co-evolution analysis to identify potential binding partners

    • Docking simulations with predicted interactors

    • Network analysis of functional associations

  • Integration with experimental data:

    • Incorporate proteomics data on abundance and modification

    • Match predicted features with observed phenotypes

    • Correlate expression patterns with functional states

The RaptorX structural prediction approach used for TspA analysis in S. aureus provides a useful model for generating structural predictions for SAOUHSC_02131 . Additionally, comparison with other UPF0316 family proteins across bacterial species can provide evolutionary context for functional predictions.

How might CRISPR-Cas9 technology be applied to study SAOUHSC_02131 in its native context?

CRISPR-Cas9 technology offers powerful approaches for studying SAOUHSC_02131 in its native context:

  • Gene editing strategies:

    • Clean deletion mutagenesis without antibiotic markers

    • Precise point mutations to test specific functional hypotheses

    • Domain swapping with homologous proteins

    • Insertion of epitope tags at the genomic locus

  • Implementation in S. aureus:

    • Delivery systems: temperature-sensitive plasmids or phage-based vectors

    • Selection markers: typically antibiotic resistance for initial selection

    • Counterselection: techniques for marker removal (e.g., IPTG-induced toxicity)

    • Verification: whole-genome sequencing to confirm edit fidelity

  • Advanced applications:

    • CRISPRi for tunable gene repression studies

    • CRISPRa for controlled overexpression

    • CRISPR-based imaging to track protein localization

    • Multiplexed editing to study genetic interactions

  • Experimental design considerations:

    • gRNA design: multiple targeting strategies to maximize efficiency

    • Repair template design: homology arms of 500-1000 bp

    • Off-target effects: comprehensive prediction and verification

    • Strain background selection: consider restriction systems

The methodologies developed for studying T7SS substrates in S. aureus provide a framework for genetic manipulation approaches that could be adapted to study SAOUHSC_02131 . When designing CRISPR experiments, researchers should include appropriate controls to account for potential polar effects on neighboring genes.

What are the most promising approaches for identifying SAOUHSC_02131 interaction partners?

Identifying interaction partners of membrane proteins like SAOUHSC_02131 requires specialized techniques:

  • Proximity-based labeling approaches:

    • BioID or TurboID fusions for biotinylation of proximal proteins

    • APEX2 for peroxidase-based proximity labeling

    • Split-BioID for conditional interaction mapping

    • Optimization parameters: expression levels, labeling time, buffer conditions

  • Crosslinking mass spectrometry (XL-MS):

    • Photo-reactive amino acid incorporation

    • Chemical crosslinkers of varying spacer lengths

    • On-membrane crosslinking protocols

    • Data analysis using specialized XL-MS software

  • Co-purification strategies:

    • Tandem affinity purification adapted for membrane proteins

    • Native extraction using digitonin or other mild detergents

    • GraFix method for stabilizing fragile complexes

    • Quantitative proteomics to distinguish specific from non-specific interactions

  • Genetic interaction screens:

    • Transposon mutagenesis combined with phenotypic selection

    • Synthetic genetic array analysis

    • High-throughput CRISPR screening

    • Suppressor mutation identification

  • Membrane-specific techniques:

    • Liposome reconstitution with purified components

    • Nanodiscs for stable membrane protein complexes

    • Native membrane vesicle isolation

Each approach has specific advantages, and researchers should select methods based on the anticipated nature of interactions (stable vs. transient) and cellular compartmentalization. The membrane localization methods described in the thesis by Ulhuq provide valuable protocols that could be adapted for studying SAOUHSC_02131 interactions .

What are the key unresolved questions about SAOUHSC_02131 function?

Despite advances in understanding membrane proteins in S. aureus, several critical questions remain unresolved regarding SAOUHSC_02131:

  • Fundamental biological role:

    • The precise physiological function remains undetermined

    • Potential involvement in membrane integrity, transport, or signaling

    • Role in stress responses or adaptation to environmental changes

    • Contribution to bacterial survival and fitness

  • Structural determinants of function:

    • Critical amino acid residues for activity

    • Topology and orientation in the membrane

    • Oligomerization state in native membrane environment

    • Conformational changes associated with function

  • Regulatory networks:

    • Transcriptional and post-transcriptional regulation

    • Environmental signals influencing expression

    • Integration with global regulatory networks

    • Potential role in stress response pathways

  • Evolutionary significance:

    • Conservation and divergence across Staphylococcal species

    • Selective pressures shaping UPF0316 family evolution

    • Potential horizontal gene transfer events

    • Functional adaptation in different bacterial lineages

Addressing these questions requires integrative approaches combining structural biology, genetics, biochemistry, and systems biology. The methodological framework established for studying S. aureus membrane proteins and secretion systems provides valuable guidance for future SAOUHSC_02131 research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.