Recombinant Staphylococcus aureus UPF0316 protein SAR2004 (SAR2004)

What is Recombinant Staphylococcus aureus UPF0316 protein SAR2004?

Recombinant Staphylococcus aureus UPF0316 protein SAR2004 is a protein derived from Staphylococcus aureus strain MRSA252, identified by UniProt accession number Q6GFE5. The full-length protein consists of 200 amino acid residues with a sequence that begins with MSFVTENPWLMVLTIFIINVCYVTFLTMRTILTLKGYRYIAASVSFLEVLVYIVGLGLVM and continues through to EELESVVEHEIQSK . As a UPF0316 family protein, it represents a protein of unknown function that has been structurally characterized but whose physiological role remains to be fully elucidated.

What expression systems are commonly used for producing recombinant SAR2004?

While the search results don't specify the expression system used for this particular protein, recombinant proteins for research typically employ bacterial (E. coli), yeast (S. cerevisiae, P. pastoris), insect cell (Sf9, High Five), or mammalian cell (CHO, HEK293) expression systems. The choice depends on research requirements including post-translational modifications, protein folding, and yield considerations. For prokaryotic proteins like SAR2004, E. coli systems often provide efficient expression, though potential issues with protein folding must be addressed through optimization of growth conditions, induction parameters, and purification strategies.

How should researchers store and handle recombinant SAR2004 protein?

According to available information, recombinant SAR2004 protein should be stored at -20°C in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein . For extended storage, conservation at -20°C or -80°C is recommended. Repeated freezing and thawing should be avoided to maintain protein integrity. Working aliquots may be stored at 4°C for up to one week . Researchers should conduct stability tests if planning extended experiments, as protein degradation can affect experimental outcomes.

What statistical considerations should guide experimental design when working with recombinant SAR2004?

When designing experiments involving recombinant proteins like SAR2004, researchers should implement proper power calculations to determine appropriate sample sizes. According to panel data analysis principles, standard methods for experimental design may yield incorrectly powered experiments if serial correlation is present in the data . For protein-based experiments, researchers should consider applying the serial-correlation-robust (SCR) power calculation technique to achieve the desired statistical power . This approach is especially important in experiments that collect multiple data points from the same samples over time, which is common in protein interaction studies.

How can researchers optimize panel data collection for protein interaction studies with SAR2004?

For panel data collection in protein interaction studies, researchers should consider both the pre- and post-treatment periods in their experimental design. The optimal design balances the number of experimental units (J) and the number of observation periods (m pre-treatment and r post-treatment periods) . When studying proteins like SAR2004, it's essential to account for within-unit correlation over time, as randomization alone cannot correct for serial correlation in panel settings . Implementing the SCR formula rather than conventional power calculation formulas can help achieve the desired statistical power, especially for experiments with multiple observation points.

What controls should be included when studying the function of SAR2004?

When investigating an uncharacterized protein like SAR2004, appropriate controls are essential. These should include: 1) Negative controls using buffer-only or irrelevant proteins of similar size/structure; 2) Positive controls using proteins with known interactions or functions similar to hypothesized roles; 3) Dose-response controls to establish concentration-dependent effects; and 4) Time-course controls to track temporal changes in interactions or activities. For interaction studies, researchers should consider including both wild-type and mutant versions of potential binding partners to validate specificity.

How might SAR2004 protein interact with host cellular mechanisms based on structural analysis?

Based on the amino acid sequence provided (MSFVTENPWLMVLTIFIINVCYVTFLTMRTILTLKGYRYIAASVSFLEVLVYIVGLGLVM SNLDHIQNIIAYAFGFSIGIIVGMKIEEKLALGYTVVNVTSAEYELDLPNELRNLGYGVT HYAAFGRDGSRMVMQILTPRKYERKLMDTIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRK LKDYEPEELESVVEHEIQSK) , computational structural analysis suggests SAR2004 contains hydrophobic regions potentially consistent with membrane association. Researchers investigating this protein should consider applying techniques such as membrane protein isolation, lipid binding assays, and subcellular localization studies to determine its cellular context. The sequence analysis also reveals potential functional motifs that might suggest interactions with nucleic acids or other proteins, which could be investigated through pull-down assays, co-immunoprecipitation, or yeast two-hybrid screening.

What methodological approaches can elucidate the potential role of SAR2004 in S. aureus pathogenesis?

To investigate SAR2004's potential role in pathogenesis, researchers should consider multifaceted approaches:

• Gene knockout studies using CRISPR-Cas9 or allelic replacement to create SAR2004-deficient S. aureus strains and assess virulence in infection models

• Complementation studies reintroducing wild-type or mutant SAR2004 to confirm phenotypes

• Transcriptomic and proteomic analyses comparing wild-type and SAR2004-deficient strains under various conditions

• Host-pathogen interaction assays examining adhesion, invasion, immune evasion, and survival

• Structural studies using X-ray crystallography or cryo-EM to identify potential interaction domains

These approaches should be integrated with appropriate statistical analyses, considering the panel data structure of many biological experiments .

How can researchers differentiate between direct and indirect effects when studying SAR2004's function?

Differentiating between direct and indirect effects requires careful experimental design. Researchers should implement:

• In vitro reconstitution experiments with purified components to demonstrate direct interactions

• Time-resolved studies to establish the sequence of events following SAR2004 activity

• Dose-dependency analyses to identify concentration thresholds for specific effects

• Domain mapping through truncation or point mutations to identify critical functional regions

• Crosslinking studies to capture transient interactions

What are the optimal analytical methods for studying potential protein-protein interactions involving SAR2004?

To study protein-protein interactions involving SAR2004, researchers should consider:

• Co-immunoprecipitation with tagged versions of SAR2004

• Surface plasmon resonance (SPR) or bio-layer interferometry (BLI) for kinetic and affinity measurements

• Isothermal titration calorimetry (ITC) for thermodynamic characterization

• Proximity labeling techniques such as BioID or APEX2 to identify proximal proteins in cellular contexts

• Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) for visualizing interactions in live cells

When analyzing data from these methods, researchers should account for possible serial correlation in measurements taken over time by applying appropriate statistical corrections .

How should researchers approach contradictory results when studying SAR2004 function?

When encountering contradictory results in SAR2004 research, apply this methodical approach:

Statistical reanalysis using serial-correlation-robust methods may resolve apparent contradictions, particularly in experiments with multiple time points or panel structure .

What bioinformatic approaches can predict functional partners for SAR2004?

To predict functional partners for SAR2004, researchers should implement:

• Sequence-based approaches including phylogenetic profiling to identify co-evolved proteins

• Gene neighborhood analysis examining genomic context conservation

• Structural homology modeling to identify potential binding interfaces

• Machine learning algorithms trained on interaction databases to predict novel partners

• Network analysis examining protein-protein interaction data from related bacterial species

These computational predictions should guide experimental validation, with appropriate statistical design considering the potential for serial correlation in validation experiments .

How might SAR2004 be evaluated as a potential vaccine candidate against Staphylococcus aureus infections?

Evaluating SAR2004 as a vaccine candidate would require systematic assessment:

• Conservation analysis across S. aureus strains to determine antigen universality

• Expression analysis during different infection stages to confirm in vivo relevance

• Accessibility studies using antibody binding to intact bacteria to verify surface exposure

• Immunogenicity testing to assess ability to elicit robust antibody and T-cell responses

• Protection studies in animal models challenged with diverse S. aureus strains

These evaluations should follow rigorous experimental design principles, including appropriate power calculations and statistical analyses . Recent clinical trials of S. aureus vaccines, like the recombinant five-antigen S. aureus vaccine (rFSAV) tested in surgical patients, provide methodological frameworks that could be adapted for SAR2004 evaluation .

What methodological approaches can assess SAR2004 immunogenicity in preclinical models?

To assess SAR2004 immunogenicity, researchers should implement:

• ELISA assays measuring antibody titers and isotype distribution

• ELISpot or flow cytometry-based assays quantifying T-cell responses

• Opsonophagocytic assays evaluating functional antibody activity

• Epitope mapping to identify immunodominant regions

• Cross-reactivity testing against related bacterial proteins to assess specificity

Statistical analyses should incorporate appropriate power calculations based on the experimental design, particularly for longitudinal studies measuring immune responses over time . Randomized designs with blinded assessment similar to those used in clinical vaccine trials can strengthen preclinical findings .

How can researchers explore potential interactions between SAR2004 and host nonsense-mediated mRNA decay (NMD) machinery?

Recent research on viral proteins interacting with nonsense-mediated mRNA decay (NMD) pathways provides interesting models for investigating potential SAR2004 interactions with host machinery . Researchers could:

• Perform immunoprecipitation assays with SAR2004 and key NMD components like UPF1 and UPF2

• Assess the impact of SAR2004 expression on NMD efficiency using reporter constructs

• Evaluate whether SAR2004 affects UPF1 unwinding activity or UPF1/UPF2 complex formation

• Investigate structural similarities between SAR2004 and viral proteins known to interact with NMD machinery

• Determine if SAR2004 expression alters global mRNA stability profiles in host cells

What novel experimental techniques might advance understanding of SAR2004 function?

Emerging technologies that could advance SAR2004 research include:

• Cryo-electron tomography to visualize SAR2004 in native cellular contexts

• Single-molecule techniques to observe real-time interactions and conformational changes

• CRISPR interference/activation systems for precise modulation of SAR2004 expression

• Protein painting or hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

• Organ-on-chip models to study SAR2004 function in complex host-pathogen interactions

These advanced approaches should incorporate appropriate experimental design principles, including power calculations that account for the statistical properties of the resulting data .

What are the key methodological challenges when working with membrane-associated proteins like SAR2004?

Membrane-associated proteins present unique challenges that researchers should address through:

• Optimized extraction protocols using detergents or amphipols appropriate for the protein's hydrophobicity profile

• Careful buffer optimization to maintain native structure and function

• Validation of proper folding and orientation using circular dichroism and tryptophan fluorescence

• Implementation of specialized techniques such as nanodiscs or liposome reconstitution to study function in membrane-like environments

• Consideration of lipid composition effects on protein behavior and interactions

Researchers should design experiments with sufficient statistical power, particularly for assays involving multiple measurements over time, by applying serial-correlation-robust power calculation techniques .

How should researchers integrate SAR2004 findings into broader understanding of S. aureus pathogenesis?

To integrate SAR2004 research into the broader understanding of S. aureus pathogenesis, researchers should:

• Map SAR2004 interactions with known virulence pathways

• Correlate SAR2004 expression with specific infection stages or host environments

• Compare phenotypes of SAR2004 mutants with other pathogenesis-related gene mutants

• Develop systems biology models incorporating SAR2004 into known interaction networks

• Validate findings across multiple clinically relevant S. aureus strains