Recombinant Staphylococcus aureus UPF0316 protein SaurJH1_2001 (SaurJH1_2001)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SaurJH1_2001; UPF0316 protein SaurJH1_2001
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Staphylococcus aureus (strain JH1)
Target Names
SaurJH1_2001
Target Protein Sequence
MSFVTENPWLMVLTIFIINVCYVTFLTMRTILTLKGYRYIAASVSFLEVLVYIVGLGLVM SNLDHIQNIIAYAFGFSIGIIVGMKIEEKLALGYTVVNVTSAEYELDLPNELRNLGYGVT HYAAFGRDGSRMVMQILTPRKYERKLMDTIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRK LKDYEPEELESVVEHEIQSK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for recombinant UPF0316 protein SaurJH1_2001?

The recombinant UPF0316 protein SaurJH1_2001 requires specific storage conditions to maintain stability and functionality:

ParameterRecommended ConditionNotes
Long-term storage-20°C or -80°CAliquoting necessary for multiple use
Working storage4°CFor up to one week
Buffer compositionTris/PBS-based buffer with 6% Trehalose, pH 8.0Optimized for stability
Physical formLyophilized powderFor long-term stability
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Add 5-50% glycerol for long-term storage
Important cautionAvoid repeated freeze-thaw cyclesCauses protein degradation

Repeated freezing and thawing significantly reduces protein stability and should be strictly avoided. The recommended practice is to reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and then add glycerol (final concentration 50%) before aliquoting for long-term storage at -20°C/-80°C .

How is recombinant UPF0316 protein SaurJH1_2001 expressed and purified?

Recombinant UPF0316 protein SaurJH1_2001 is typically expressed in E. coli expression systems. The full-length protein (amino acids 1-200) is fused to an N-terminal His tag to facilitate purification. The His tag enables purification through metal affinity chromatography, typically using nickel or cobalt resins that selectively bind the polyhistidine sequence .

The purification process generally follows these steps:

  • Bacterial cell lysis to release the recombinant protein

  • Initial clarification of the lysate by centrifugation

  • Metal affinity chromatography using the His tag

  • Optional: Size exclusion chromatography for further purification

  • Quality control by SDS-PAGE to verify purity (>90%)

  • Lyophilization for stable storage

If problems with truncated products occur during expression, increasing the imidazole concentration during elution can help distinguish full-length proteins from truncated versions .

What quality control methods are used to verify recombinant UPF0316 protein SaurJH1_2001 integrity?

Quality control of recombinant UPF0316 protein SaurJH1_2001 typically involves multiple analytical techniques:

Analytical MethodPurposeExpected Result
SDS-PAGEAssess purity and molecular weight>90% purity, single band at expected MW
Western blotConfirm identity using anti-His antibodiesSingle specific band
Mass spectrometryVerify exact molecular weight and sequenceMatch to theoretical mass
Circular dichroismEvaluate secondary structureConsistent folding pattern
Dynamic light scatteringDetect aggregationMonodisperse population
Endotoxin testingEnsure safety for biological assays<1 EU/mg protein

For this specific protein, SDS-PAGE is the primary method reported to verify purity, with a standard of greater than 90% being acceptable for most research applications .

What are the potential functions of UPF0316 protein SaurJH1_2001 in Staphylococcus aureus biology?

While the specific function of UPF0316 protein SaurJH1_2001 is not fully characterized, several approaches can be used to predict and investigate its role:

  • Sequence analysis suggests membrane association, indicating potential roles in:

    • Membrane transport or channel activity

    • Cell signaling

    • Cell wall integrity maintenance

    • Antibiotic resistance mechanisms

    • Host-pathogen interactions

  • Comparative genomics with related proteins in other bacterial species may provide functional clues. The UPF0316 family proteins are conserved across multiple bacterial species, suggesting an important biological role .

  • Gene expression analysis under different stress conditions could reveal patterns of upregulation or downregulation that correlate with specific cellular responses. For instance, examining expression during antibiotic exposure, nutrient limitation, or host interaction may provide functional insights .

To experimentally determine function, researchers should consider gene knockout studies followed by comprehensive phenotypic characterization, including growth rates, antibiotic susceptibility, and virulence in infection models.

How can experimental design principles be applied to study UPF0316 protein SaurJH1_2001 function?

Robust experimental design for studying UPF0316 protein SaurJH1_2001 function should incorporate the principles outlined by Fisher, focusing on manipulation of independent variables, appropriate controls, and careful measurement of dependent variables .

A comprehensive experimental approach might include:

Experimental ApproachKey Design ElementsExpected Outcomes
Gene knockout studies- CRISPR-Cas9 or allelic replacement
- Multiple independent mutants
- Complementation controls
- Randomized blinded phenotypic assays
Phenotypic changes revealing physiological role
Protein localization- Fluorescent protein fusion
- Immunofluorescence microscopy
- Subcellular fractionation
- Controls for fixation artifacts
Cellular localization pattern
Interactome analysis- Co-immunoprecipitation
- Cross-linking mass spectrometry
- Yeast two-hybrid screening
- Negative controls
Protein interaction network
Structural studies- X-ray crystallography
- NMR spectroscopy
- Cryo-EM
- Molecular modeling
Three-dimensional structure revealing functional domains

When designing these studies, researchers should employ the Solomon four-group design where appropriate to control for testing effects, especially in time-sensitive experiments . This design helps distinguish between the effects of pretesting, treatment, and their interaction by randomly assigning experimental units to four different groups.

What is known about the potential role of UPF0316 protein SaurJH1_2001 in Staphylococcus aureus virulence?

While specific information about UPF0316 protein SaurJH1_2001's role in virulence is not directly available, we can contextualize potential contributions based on S. aureus pathogenesis.

S. aureus virulence depends on multiple factors including:

  • Adhesion proteins (like fibronectin-binding protein A and clumping factor A)

  • Toxins and enzymes

  • Immune evasion mechanisms

  • Biofilm formation

The UPF0316 protein's membrane association suggests potential involvement in one or more of these processes. For comparison, other S. aureus membrane proteins have established roles in virulence:

ProteinRole in VirulenceComparison to UPF0316
Fibronectin-binding protein A (FnbA)Mediates adhesion to host extracellular matrixBoth are membrane-associated; UPF0316 could similarly mediate host interactions
Clumping factor APromotes bacterial attachment to fibrinogenCell surface-associated virulence factor; UPF0316 might have similar adhesive properties
Membrane transportersNutrient acquisition during infectionUPF0316 membrane location suggests possible transport function

To investigate UPF0316 protein's role in virulence, researchers should:

  • Generate knockout mutants and test in infection models

  • Assess adhesion to relevant host cells

  • Examine immune response to the protein

  • Test for interactions with host proteins

How can statistical approaches be applied to analyze data from UPF0316 protein SaurJH1_2001 research?

Statistical analysis for UPF0316 protein research requires careful consideration of experimental design and data types. Based on statistical principles from experimental research, the following approaches are recommended :

  • For comparing multiple experimental conditions (e.g., different mutations or treatments):

    • ANOVA followed by appropriate post-hoc tests

    • Control for multiple comparisons using methods such as Bonferroni or Tukey's HSD

    • Include power analysis to determine adequate sample sizes

  • For time-series data (e.g., protein expression over time):

    • Repeated measures ANOVA for parametric data

    • Hazard function analysis for survival or failure time data

    • Time-series models for temporal dependencies

  • For protein-protein interaction studies:

    • Calculate correlation coefficients (Pearson's r for parametric data)

    • Spearman's rank correlation for non-parametric data

    • Analysis of concordant and discordant pairs for binary outcomes

  • For exploring complex datasets:

    • Principal component analysis (PCA) for dimension reduction

    • Hierarchical clustering to identify patterns

    • Exploratory data visualization using "branch and leaf" plots

When analyzing protein function data, researchers should consider both statistical significance and biological significance, as statistically significant findings may not always translate to meaningful biological effects.

What approaches can be used to study protein-protein interactions of UPF0316 protein SaurJH1_2001?

Understanding the interaction partners of UPF0316 protein SaurJH1_2001 is crucial for elucidating its function. Several complementary methods can be employed:

MethodTechnical ApproachAdvantagesLimitations
Co-immunoprecipitationUse anti-His antibodies to pull down UPF0316 and identify interacting proteins by mass spectrometryIdentifies physiologically relevant interactionsMay miss weak or transient interactions
Bacterial two-hybridExpress UPF0316 fused to DNA-binding domain and test against prey libraryHigh-throughput screeningPotential false positives/negatives
Surface plasmon resonanceImmobilize UPF0316 on chip and measure binding kinetics of potential partnersProvides quantitative binding dataRequires purified interaction partners
Cross-linking mass spectrometryChemical cross-linking followed by MS/MS analysisIdentifies interaction interfacesComplex data analysis
Proximity-dependent biotin labelingExpress UPF0316 fused to biotin ligaseIdentifies proteins in close proximity in vivoRequires genetic manipulation of S. aureus

A successful example of protein interaction analysis in S. aureus is seen with the metastasis suppressor NME1 and dynamin (DNM2), where two-way co-immunoprecipitation confirmed their interaction, providing insights into their functional relationship .

For UPF0316 protein SaurJH1_2001, researchers should first identify potential interaction partners through large-scale methods like co-immunoprecipitation followed by mass spectrometry, then validate specific interactions using targeted approaches like surface plasmon resonance or ELISA.

How can recombinant UPF0316 protein SaurJH1_2001 be utilized in vaccine development against Staphylococcus aureus?

Developing effective vaccines against S. aureus remains challenging due to the bacterium's complex pathogenesis and immune evasion mechanisms. To evaluate UPF0316 protein SaurJH1_2001 as a potential vaccine candidate, researchers should consider the following approaches:

  • Antigenicity assessment:

    • Analyze sequence conservation across S. aureus strains

    • Predict B-cell and T-cell epitopes using immunoinformatics

    • Test immunogenicity in animal models

  • Protective efficacy evaluation:

    • Measure antibody response (quantity and functionality)

    • Assess T-cell responses

    • Challenge immunized animals with S. aureus

  • Adjuvant optimization:

    • Test various adjuvant formulations

    • Evaluate different delivery systems

    • Measure impact on immune response quality

Previous S. aureus vaccine development efforts have encountered challenges, as seen with the capsular polysaccharide vaccine that showed modest efficacy (57-63%) that diminished over time . UPF0316 protein's potential as a vaccine candidate would need to be evaluated in light of these historical challenges.

A promising approach might be to include UPF0316 protein as part of a multi-component vaccine, targeting several virulence factors simultaneously to overcome the redundancy in S. aureus pathogenicity mechanisms .

What methods are appropriate for studying the structure-function relationship of UPF0316 protein SaurJH1_2001?

Understanding the relationship between UPF0316 protein structure and function requires integrating multiple experimental and computational approaches:

  • Structural analysis methods:

    • X-ray crystallography for high-resolution static structure

    • NMR spectroscopy for solution structure and dynamics

    • Cryo-electron microscopy for larger assemblies

    • Circular dichroism for secondary structure content

  • Functional mapping approaches:

    • Site-directed mutagenesis of conserved residues

    • Deletion analysis of predicted domains

    • Chimeric protein construction

    • Chemical modifications of specific residues

  • Computational methods:

    • Homology modeling based on related structures

    • Molecular dynamics simulations

    • Protein-ligand docking

    • Evolutionary sequence analysis

A systematic approach would begin with in silico structure prediction and identification of conserved regions, followed by experimental validation through targeted mutagenesis. Functional assays would then be designed based on hypothesized roles, such as membrane transport, protein interaction, or enzymatic activity.

How can exploratory data analysis be applied to UPF0316 protein research?

Exploratory data analysis (EDA) provides valuable insights before formal hypothesis testing. For UPF0316 protein research, EDA approaches can reveal patterns and generate hypotheses :

  • Data visualization techniques:

    • "Branch and leaf" plots for organizing clinical or experimental data

    • Heat maps for expression data across conditions

    • Network graphs for protein interaction data

    • Scatter plots for structure-function correlations

  • Descriptive statistics approaches:

    • Measures of central tendency and dispersion

    • Frequency distributions

    • Correlation analyses between variables

    • Contingency tables for categorical outcomes

  • Pattern recognition methods:

    • Cluster analysis to identify groups with similar characteristics

    • Principal component analysis to reduce dimensionality

    • Time series analysis for temporal patterns

    • Hazard function analysis for failure patterns

The qualitative behavior of the hazard function can reveal whether certain events (e.g., protein misfolding, aggregation, or activity loss) are increasing, decreasing, or constant over time . These informal procedures can provide important insights before formal statistical analysis.

What are the most critical unanswered questions about UPF0316 protein SaurJH1_2001?

Despite the available knowledge about UPF0316 protein SaurJH1_2001's sequence, expression, and handling, several critical questions remain unanswered:

  • What is the precise biological function of this protein in S. aureus?

  • Does it contribute to pathogenesis or antibiotic resistance?

  • What proteins does it interact with in vivo?

  • What is its three-dimensional structure?

  • Is it conserved across different S. aureus strains and isolates?

  • Could it serve as a therapeutic target or vaccine component?

Future research should prioritize these questions, using a combination of genetic, biochemical, structural, and immunological approaches. The integration of advanced techniques like CRISPR-Cas9 gene editing, cryo-electron microscopy, and systems biology approaches will be essential to fully characterize this protein.

How can researchers address the challenges in studying uncharacterized proteins like UPF0316 protein SaurJH1_2001?

Studying uncharacterized proteins presents unique challenges that require systematic approaches:

  • Develop multiple working hypotheses based on:

    • Sequence homology with characterized proteins

    • Genomic context and organization

    • Expression patterns under different conditions

    • Predicted structural features

  • Implement parallel experimental strategies:

    • Both forward and reverse genetic approaches

    • Complementary structural analysis methods

    • Multiple protein interaction detection systems

    • In vitro and in vivo functional assays

  • Utilize integrative data analysis:

    • Combine results from multiple experimental approaches

    • Apply machine learning to detect patterns in complex datasets

    • Develop computational models to generate testable predictions

    • Collaborate across disciplines to gain diverse perspectives

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.