Recombinant Staphylococcus aureus UPF0316 protein SaurJH9_1967 (SaurJH9_1967)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to concentrate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SaurJH9_1967; UPF0316 protein SaurJH9_1967
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Staphylococcus aureus (strain JH9)
Target Names
SaurJH9_1967
Target Protein Sequence
MSFVTENPWLMVLTIFIINVCYVTFLTMRTILTLKGYRYIAASVSFLEVLVYIVGLGLVM SNLDHIQNIIAYAFGFSIGIIVGMKIEEKLALGYTVVNVTSAEYELDLPNELRNLGYGVT HYAAFGRDGSRMVMQILTPRKYERKLMDTIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRK LKDYEPEELESVVEHEIQSK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Staphylococcus aureus UPF0316 protein SaurJH9_1967?

Recombinant Staphylococcus aureus UPF0316 protein SaurJH9_1967 is a protein from the UPF0316 family expressed in S. aureus strain JH9. The "UPF" designation (Uncharacterized Protein Family) indicates that the protein's precise function remains to be fully elucidated. The recombinant form is produced using expression systems that allow for the protein to be generated and purified for experimental studies. According to available data, this protein is commercially available through suppliers such as CUSABIO TECHNOLOGY LLC for research purposes .

How does SaurJH9_1967 compare to other regulatory proteins in S. aureus?

While specific comparative data for SaurJH9_1967 is limited, we can draw insights from well-characterized S. aureus regulatory proteins. For example, SarA, a DNA-binding regulatory protein in S. aureus, functions as a transcription factor capable of acting as either a repressor or activator. SarA is present at approximately 50,000 copies per cell across all growth stages, which is considerably higher than typical transcription factors . The binding affinity of SarA is responsive to redox state, suggesting environmental sensitivity. When studying SaurJH9_1967, researchers should consider:

Protein CharacteristicSarA (Known Regulatory Protein) Implications for SaurJH9_1967 Research
Cellular concentration~50,000 copies per cellDetermine if SaurJH9_1967 has similar abundance or follows classical transcription factor patterns
Growth phase expressionPresent at all growth stagesInvestigate if SaurJH9_1967 expression varies with growth phase
Environmental responsivenessSensitive to redox state and pHTest SaurJH9_1967 function under varied environmental conditions
DNA-binding propertiesBinds with high affinity; forms complexesAssess DNA-binding capability of SaurJH9_1967

What techniques are recommended for purifying recombinant SaurJH9_1967?

Purification of recombinant SaurJH9_1967 typically employs affinity chromatography as a primary technique, often using a histidine tag for IMAC (Immobilized Metal Affinity Chromatography). This should be followed by secondary purification steps to ensure high purity. A recommended purification workflow includes:

  • Affinity chromatography (His-tag or GST-tag based)

  • Ion exchange chromatography to remove contaminants with different charge properties

  • Size exclusion chromatography for final polishing and buffer exchange

  • Quality assessment via SDS-PAGE and Western blotting

Researchers should optimize buffer conditions based on predicted protein properties, testing different pH values and salt concentrations. For S. aureus proteins, adding reducing agents may be beneficial as protein activity can be affected by redox conditions, similar to what has been observed with SarA .

How can I design experiments to investigate potential DNA-binding properties of SaurJH9_1967?

Given that some S. aureus regulatory proteins like SarA exhibit DNA-binding capabilities , investigating similar properties in SaurJH9_1967 is important. A comprehensive experimental approach should include:

  • Electrophoretic Mobility Shift Assays (EMSA): Testing binding to various DNA sequences, with attention to different redox conditions as these have been shown to affect SarA binding patterns.

  • Chromatin Immunoprecipitation (ChIP): For identifying potential genomic targets in vivo.

  • DNase I footprinting: To precisely map binding sites.

  • Surface Plasmon Resonance (SPR): For quantitative determination of binding kinetics.

When analyzing results, researchers should present both the raw gel images/binding curves and quantitative analyses in tables as demonstrated below:

Experimental ConditionDNA Binding Affinity (Kd)Complex FormationEffects of Redox State
Reducing conditions[Determined value] nM[Observed pattern][Comparative analysis]
Oxidizing conditions[Determined value] nM[Observed pattern][Comparative analysis]
Neutral pH[Determined value] nM[Observed pattern][Comparative analysis]
Acidic pH[Determined value] nM[Observed pattern][Comparative analysis]

What controls should be included when working with SaurJH9_1967?

Robust experimental design requires appropriate controls. For SaurJH9_1967 studies, researchers should include:

  • Positive controls: Well-characterized S. aureus proteins with known functions (e.g., SarA for DNA-binding experiments )

  • Negative controls: Non-related proteins with different properties

  • Mock purifications: Extracts from expression systems without the target protein

  • Buffer-only controls: To establish baselines for binding assays

  • Denatured protein controls: To confirm that observed activities require native protein conformation

Including these controls helps distinguish specific activities of SaurJH9_1967 from non-specific effects or experimental artifacts, particularly important when working with proteins of unknown function.

How can I systematically characterize the function of SaurJH9_1967?

Characterizing proteins with unknown function requires a multi-dimensional approach. For SaurJH9_1967, consider this hierarchical workflow:

  • Sequence-based analysis: Identify conserved domains, motifs, and homology to proteins with known functions.

  • Structural characterization: Use X-ray crystallography, NMR, or cryo-EM to determine protein structure, which may provide functional insights.

  • Protein-protein interaction studies:

    • Pull-down assays

    • Yeast two-hybrid screening

    • Co-immunoprecipitation

    • Proximity labeling approaches (BioID, APEX)

  • Gene knockout/knockdown studies: Analyze phenotypic changes in S. aureus when SaurJH9_1967 expression is altered.

  • Transcriptomics/proteomics: Compare global cellular changes in response to SaurJH9_1967 perturbation.

For each approach, data should be presented using clear tables comparing experimental and control conditions, with appropriate statistical analyses. Researchers should consider potential redundancy in protein function, particularly in bacteria like S. aureus that have evolved complex regulatory networks.

How might environmental conditions affect SaurJH9_1967 function?

S. aureus proteins often exhibit environmental sensitivity. For instance, SarA's DNA-binding activity is responsive to redox state and pH changes . When investigating SaurJH9_1967, researchers should systematically evaluate:

  • Redox sensitivity: Test protein activity under reducing and oxidizing conditions.

  • pH responsiveness: Evaluate function across physiologically relevant pH ranges.

  • Temperature effects: Assess activity at different temperatures, including fever-range temperatures relevant to infection.

  • Ionic strength/metal ion requirements: Determine if specific ions enhance or inhibit activity.

  • Growth phase dependency: Compare protein activity in extracts from different bacterial growth phases.

This environmental response profiling is particularly important for S. aureus proteins, as the bacterium encounters diverse environments during colonization and infection. Results should be presented as activity profiles across environmental gradients, using quantitative metrics specific to the protein's measured function.

How should I analyze discrepancies in experimental results with SaurJH9_1967?

When working with poorly characterized proteins like SaurJH9_1967, experimental discrepancies are common and should be approached systematically:

  • Technical validation: Repeat experiments with increased technical and biological replicates. Present data with error bars indicating standard deviation or standard error, and appropriate statistical tests .

  • Condition validation: Test if discrepancies are related to subtle variations in experimental conditions (pH, temperature, redox state).

  • Isoform analysis: Investigate if SaurJH9_1967 has multiple forms or undergoes post-translational modifications that might explain variable results.

  • Cross-technique validation: Confirm results using orthogonal methods. For example, if DNA binding is observed by EMSA, validate with SPR or fluorescence polarization.

When presenting discrepant results, use clear tables comparing methodologies, conditions, and outcomes:

Experimental ApproachCondition Set ACondition Set BReconciliation Strategy
Method 1[Result][Result][Approach for resolving differences]
Method 2[Result][Result][Approach for resolving differences]
Method 3[Result][Result][Approach for resolving differences]

What computational approaches can predict the function of SaurJH9_1967?

Computational methods provide valuable insights for proteins of unknown function like SaurJH9_1967:

  • Homology modeling: Build structural models based on homologous proteins with known structures.

  • Molecular dynamics simulations: Explore conformational changes and potential binding sites.

  • Gene neighborhood analysis: Examine genomic context for functional associations.

  • Co-expression network analysis: Identify proteins with similar expression patterns across conditions.

  • Phylogenetic profiling: Compare presence/absence patterns across bacterial species.

  • Text mining: Extract potential functional associations from scientific literature.

Researchers should integrate predictions from multiple computational approaches and design experiments to test these predictions. Results should be presented with clear indications of prediction confidence scores and experimental validation status.

How might SaurJH9_1967 contribute to bacterial adaptation and evolution?

Recent research has demonstrated that S. aureus can undergo adaptation to challenging environments through genetic mutations. For example, when cocultured with Pseudomonas aeruginosa, S. aureus evolved mutations in the aspartate transporter gene gltT, which altered amino acid metabolism and increased tolerance to P. aeruginosa . Similar evolutionary studies could reveal if SaurJH9_1967 plays a role in adaptation to specific environmental pressures.

To investigate this:

  • Design experimental evolution studies exposing S. aureus to relevant stressors (antibiotics, host immune factors, competing bacteria).

  • Monitor changes in SaurJH9_1967 sequence, expression, or activity over time.

  • Create SaurJH9_1967 knockout strains and assess their fitness under various selective pressures.

  • Compare SaurJH9_1967 sequences across clinical isolates from different infection sites to identify potential adaptive mutations.

This research direction connects protein-level studies to broader ecological and evolutionary questions in bacterial pathogenesis.

How might SaurJH9_1967 interact with known S. aureus regulatory networks?

S. aureus employs complex regulatory networks to control virulence factor expression. SarA, for instance, can function as both a repressor and activator in these networks . To position SaurJH9_1967 within these networks:

  • Conduct global transcriptional profiling comparing wild-type and SaurJH9_1967 mutant strains.

  • Perform genetic epistasis experiments with known regulatory genes.

  • Use chromatin immunoprecipitation sequencing (ChIP-seq) to identify potential genomic targets.

  • Develop reporter systems to monitor how SaurJH9_1967 affects expression of key virulence genes.

Results should be presented as network diagrams with SaurJH9_1967 integrated into known regulatory pathways, supported by quantitative expression data.

Regulatory ScenarioEffect on Virulence Gene ExpressionSaurJH9_1967 ActivityInteraction with SarA or other regulators
Standard laboratory conditions[Expression pattern][Measured activity][Observed interactions]
Infection-mimicking conditions[Expression pattern][Measured activity][Observed interactions]
Antibiotic stress[Expression pattern][Measured activity][Observed interactions]
Oxidative stress[Expression pattern][Measured activity][Observed interactions]

What is the potential significance of SaurJH9_1967 in S. aureus pathogenesis?

Understanding how SaurJH9_1967 contributes to S. aureus pathogenesis requires integrating molecular function with infection biology:

  • Infection models: Compare virulence of wild-type and SaurJH9_1967 mutant strains in relevant animal models.

  • Host cell interaction studies: Assess effects on adhesion, invasion, and intracellular survival.

  • Immune evasion: Investigate potential roles in resisting host immune defenses.

  • Biofilm formation: Examine contributions to biofilm development and maintenance.

  • Antimicrobial resistance: Explore potential connections to antibiotic tolerance or resistance mechanisms.

This translational research bridges fundamental protein characterization to clinical relevance, potentially identifying new therapeutic targets if SaurJH9_1967 proves important for pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.