Recombinant Staphylococcus aureus UPF0316 protein SAUSA300_1892 (SAUSA300_1892)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SAUSA300_1892; UPF0316 protein SAUSA300_1892
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Staphylococcus aureus (strain USA300)
Target Names
SAUSA300_1892
Target Protein Sequence
MSFVTENPWLMVLTIFIINICYVTFLTMRTILTLKGYRYIAASVSFLEVLVYIVGLGLVM SNLDHIQNIIAYAFGFSIGIIVGMKIEEKLALGYTVVNVTSAEYELDLPNELRNLGYGVT HYAAFGRDGSRMVMQILTPRKYERKLMDTIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRK LKDYEPEELESVVEHEIQSK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Staphylococcus aureus UPF0316 protein SAUSA300_1892?

Staphylococcus aureus UPF0316 protein SAUSA300_1892 is a protein found in Staphylococcus aureus strain USA300. It belongs to the UPF0316 protein family, which consists of proteins with currently uncharacterized functions. The protein is 200 amino acids in length and has been identified in the genome of S. aureus, a gram-positive, round-shaped bacterium commonly found in the upper respiratory tract and on human skin . This bacterium can act as both a commensal organism and an opportunistic pathogen capable of causing various infections ranging from minor skin conditions to life-threatening diseases .

What molecular and structural characteristics define SAUSA300_1892?

SAUSA300_1892 is classified as a UPF0316 family protein with a full length of 200 amino acids. The protein has a UniProt identifier of Q2FFI4 . Analysis of the amino acid sequence suggests it likely contains hydrophobic segments that may function as transmembrane domains, particularly evident in the N-terminal region. The sequence MSFVTENPWLMVLTIFIINICYVTFLT contains a high proportion of hydrophobic residues consistent with membrane association . Current structural data remains limited, though bioinformatic analysis suggests potential membrane integration, which would be consistent with many bacterial virulence factors.

How should I design experiments to study SAUSA300_1892 function?

When designing experiments to study SAUSA300_1892 function, consider the following approach:

  • Define clear variables: Establish independent variables (e.g., protein concentration, environmental conditions) and dependent variables (e.g., cellular responses, binding activity) relevant to your hypothesis .

  • Controls: Include appropriate positive and negative controls. For SAUSA300_1892 studies, consider using:

    • Negative controls: Buffer-only conditions or irrelevant proteins of similar size

    • Positive controls: Known S. aureus proteins with established functions

    • Genetic controls: S. aureus strains with SAUSA300_1892 deletion or mutation

  • Quantitative measurements: Develop clear metrics to measure protein activity. This might include binding assays, reporter systems, or phenotypic changes in model systems .

  • Experimental conditions: Test protein function under physiologically relevant conditions that mimic the native environment of S. aureus.

  • Reproducibility: Design your experiment with sufficient replication to ensure statistical validity .

A mixed-method approach combining quantitative measurements with qualitative observations often yields the most comprehensive insights when studying proteins of unknown function .

What expression systems are most effective for producing recombinant SAUSA300_1892?

Based on available data, several expression systems can be used for producing recombinant SAUSA300_1892:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, rapid growth, cost-effectiveMay require optimization of codon usage, potential for inclusion body formation
YeastBetter for eukaryotic-like post-translational modificationsLonger expression time, lower yields than E. coli
BaculovirusComplex eukaryotic protein processingMore technically demanding, higher cost
Mammalian cellsHighest fidelity for complex proteinsMost expensive, lowest yield, longest timeframe

The most commonly used system appears to be E. coli, though the optimal choice depends on specific experimental requirements . When expressing membrane-associated bacterial proteins like SAUSA300_1892, E. coli often provides a good balance of yield and proper folding.

What storage and handling protocols maximize SAUSA300_1892 stability?

For optimal stability and activity of recombinant SAUSA300_1892:

  • Storage conditions: Store at -20°C in a Tris-based buffer with 50% glycerol. For extended storage periods, -80°C is recommended .

  • Aliquoting: Prepare small working aliquots to avoid repeated freeze-thaw cycles, as this can compromise protein integrity.

  • Short-term storage: Working aliquots can be maintained at 4°C for up to one week .

  • Freeze-thaw considerations: Repeated freezing and thawing is not recommended as it can lead to protein degradation and activity loss .

  • Buffer optimization: The standard storage buffer (Tris-based with 50% glycerol) has been optimized specifically for this protein .

Following these guidelines will help maintain protein integrity and experimental reproducibility.

How can SAUSA300_1892 be used in Staphylococcus aureus pathogenicity studies?

SAUSA300_1892 can be utilized in pathogenicity studies through several methodological approaches:

  • Localization studies: Using immunofluorescence microscopy with fluorophore-conjugated antibodies can reveal the spatial distribution of SAUSA300_1892 on the bacterial surface, similar to protein A visualization techniques . This approach helps determine if the protein is uniformly distributed or localized to specific regions of the bacterial cell.

  • Temporal expression analysis: By combining protease treatment to remove existing surface proteins followed by timed sample collection, researchers can track the deposition pattern of newly synthesized SAUSA300_1892 . This reveals the dynamic nature of protein expression during bacterial growth and infection stages.

  • Mutation studies: Creating knockout strains lacking SAUSA300_1892 and comparing their virulence to wild-type strains in infection models can establish the protein's role in pathogenicity.

  • Host-pathogen interaction assays: Assessing how SAUSA300_1892 interacts with host immune components using techniques like co-immunoprecipitation, ELISA, or surface plasmon resonance.

These approaches should be combined with appropriate controls, including mutant strains (such as sortase A mutants that affect protein anchoring) to validate findings .

What methods can detect interactions between SAUSA300_1892 and host proteins?

To investigate interactions between SAUSA300_1892 and host proteins, consider these methodological approaches:

  • Pull-down assays: Using His-tagged recombinant SAUSA300_1892 protein to capture potential binding partners from host cell lysates, followed by mass spectrometry identification.

  • Yeast two-hybrid screening: For identifying direct protein-protein interactions, though this may have limitations for membrane-associated proteins.

  • Proximity labeling: Using BioID or APEX2 fusions to SAUSA300_1892 to identify proteins in close proximity within living cells.

  • Surface plasmon resonance (SPR): For quantitative measurement of binding kinetics between purified SAUSA300_1892 and candidate host proteins.

  • Co-immunoprecipitation: Using antibodies against SAUSA300_1892 to precipitate protein complexes from infection models.

For all these methods, appropriate controls must be included to distinguish specific from non-specific interactions. Verification of interactions should employ multiple complementary techniques to increase confidence in the results.

How can I design experiments to analyze SAUSA300_1892 localization in bacterial cells?

To study SAUSA300_1892 localization in bacterial cells, consider adapting the methodology used for protein A localization studies in S. aureus :

  • Sample preparation protocol:

    • Grow S. aureus to appropriate growth phase (mid-log phase, OD660 of 0.6)

    • Sediment cells by centrifugation and wash in PBS

    • Disperse cells by gentle sonication to prevent clustering

    • Fix cells with glutaraldehyde or paraformaldehyde

  • Immunofluorescence approach:

    • Develop specific antibodies against SAUSA300_1892 or use epitope tagging

    • Label with fluorophore-conjugated secondary antibodies

    • Consider dual labeling with cell wall markers (e.g., vancomycin-BODIPY) for co-localization studies

  • Comparative analysis:

    • Include wild-type strains and appropriate mutants

    • Analyze cells at different growth phases

    • Compare localization patterns under various environmental conditions

  • Imaging techniques:

    • Use confocal microscopy for high-resolution localization

    • Consider super-resolution techniques (STED, STORM) for detailed subcellular localization

    • Perform z-stack imaging to capture the complete three-dimensional distribution

Quantitative analysis of fluorescence distribution will provide insights into the spatial organization of SAUSA300_1892 on the bacterial surface .

What statistical approaches are appropriate for analyzing SAUSA300_1892 experimental data?

When analyzing experimental data related to SAUSA300_1892, select statistical methods based on your experimental design and data characteristics:

Regardless of the approach, ensure proper reporting of:

  • Sample sizes

  • P-values

  • Effect sizes

  • Confidence intervals

  • Test assumptions and validation

How do I address potential artifacts in SAUSA300_1892 recombinant protein studies?

When working with recombinant SAUSA300_1892, several artifacts may arise that require methodological consideration:

  • Expression tags influence: His-tags or other fusion elements may affect protein folding or function . Address this by:

    • Comparing tagged and tag-cleaved versions of the protein

    • Testing multiple tag positions (N-terminal vs. C-terminal)

    • Using small tags when possible

  • Protein aggregation: Membrane-associated proteins like SAUSA300_1892 may aggregate in solution. Mitigate by:

    • Optimizing buffer conditions (detergents, salt concentration)

    • Using analytical size exclusion chromatography to verify monodispersity

    • Performing dynamic light scattering to assess aggregation state

  • Endotoxin contamination: When expressed in E. coli, endotoxin can co-purify with the target protein. Address by:

    • Including endotoxin removal steps in purification

    • Testing final preparations with LAL assays

    • Including endotoxin-only controls in cellular experiments

  • Improper folding: Verify proper protein folding through:

    • Circular dichroism spectroscopy

    • Limited proteolysis assays

    • Activity assays with known substrates or partners

Transparent reporting of these quality control measures strengthens the validity of research findings.

What are promising research avenues for understanding SAUSA300_1892 function?

Future research on SAUSA300_1892 could productively focus on several key areas:

  • Structural characterization: Determining the three-dimensional structure through X-ray crystallography or cryo-EM would provide insights into functional domains and potential interaction surfaces.

  • Functional genomics approaches: CRISPR-based screens in S. aureus to identify genetic interactions with SAUSA300_1892, potentially revealing functional pathways.

  • Comparative genomics: Analyzing homologs across bacterial species to identify conserved regions that might indicate functional importance.

  • Temporal expression studies: Examining SAUSA300_1892 expression during different growth phases and infection stages, similar to protein A deposition studies .

  • Host-pathogen interface: Investigating potential roles in immune evasion, adhesion, or invasion of host tissues, which are common functions for surface-exposed bacterial proteins.

  • Antimicrobial target assessment: Evaluating SAUSA300_1892 as a potential target for new antimicrobial strategies, particularly if it proves essential for virulence or survival.

These research directions would benefit from integrating multiple experimental approaches, including both in vitro biochemical studies and in vivo infection models.

How might SAUSA300_1892 contribute to antimicrobial resistance research?

As antibiotic resistance in S. aureus continues to be a significant clinical challenge, SAUSA300_1892 research could contribute to this field in several ways:

  • Alternative drug target: If SAUSA300_1892 proves essential for bacterial survival or virulence, it could represent a novel target for antimicrobial development, potentially circumventing existing resistance mechanisms.

  • Biomarker potential: Expression levels of SAUSA300_1892 might correlate with specific resistance phenotypes or virulence characteristics, making it a potential biomarker.

  • Structural vaccinology approach: If surface-exposed, SAUSA300_1892 could be evaluated as a vaccine antigen candidate , potentially providing protection against resistant strains.

  • Resistance mechanism studies: Investigating whether SAUSA300_1892 plays a role in established resistance mechanisms (biofilm formation, cell wall modification, etc.).

  • Strain typing: Sequence variations in SAUSA300_1892 across clinical isolates might provide insights into the evolution and spread of resistant lineages.

Methodological approaches would include comparative genomics, functional assays in resistant isolates, and structure-based drug design if the protein proves to be a viable target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.