Recombinant Staphylococcus aureus UPF0316 protein SAV1911 (SAV1911)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SAV1911; UPF0316 protein SAV1911
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Staphylococcus aureus (strain Mu50 / ATCC 700699)
Target Names
SAV1911
Target Protein Sequence
MSFVTENPWLMVLTIFIINVCYVTFLTMRTILTLKGYRYIAASVSFLEVLVYIVGLGLVM SNLDHIQNIIAYAFGFSIGIIVGMKIEEKLALGYTVVNVTSAEYELDLPNELRNLGYGVT HYAAFGRDGSRMVMQILTPRKYERKLMDTIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRK LKDYEPEELESVVEHEIQSK
Uniprot No.

Target Background

Database Links

KEGG: sav:SAV1911

STRING: 158878.SAV1911

Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of SAV1911, and how does it compare to other S. aureus surface proteins?

SAV1911 is a member of the UPF0316 protein family found in S. aureus. While specific structural details of SAV1911 require further characterization, approaches similar to those used for other S. aureus surface proteins can be applied. For example, researchers have successfully characterized the domain structure of S. aureus surface protein G (SasG), which contains domain A and domain B with repetitive peptides . Using comparable methodologies, SAV1911's structure could be analyzed through:

  • X-ray crystallography of purified recombinant protein

  • Computational modeling based on homologous proteins

  • Domain mapping through limited proteolysis and mass spectrometry

  • Structural comparison with other UPF0316 family proteins

For experimental structural determination, researchers should consider expressing SAV1911 as fusion proteins with tags like MBP (maltose-binding protein) to enhance solubility, similar to approaches used for SasG fragments .

How is SAV1911 gene expression regulated during different phases of S. aureus growth and infection?

Gene expression regulation of SAV1911 can be studied using approaches that have been applied to other S. aureus genes during infection. Transcriptomic analysis of S. aureus-infected tissues has demonstrated significant changes in bacterial gene expression in response to host environments . To characterize SAV1911 expression:

  • Perform qRT-PCR analysis of SAV1911 during different growth phases using primers designed specifically for the gene

  • Employ RNA-Seq technology to analyze SAV1911 expression profiles in various environmental conditions

  • Compare expression levels between different S. aureus strains (MRSA vs. MSSA)

  • Analyze promoter regions for regulatory elements that respond to environmental signals

Studies have shown that S. aureus genes involved in host-pathogen interactions often display distinct expression patterns during infection compared to laboratory culture conditions . SAV1911 expression should be examined in both contexts to understand its potential role in pathogenesis.

What are the predicted functional roles of SAV1911 based on sequence homology and domain architecture?

While detailed functional characterization of SAV1911 requires experimental validation, initial predictions can be made through bioinformatic approaches:

  • Sequence alignment with functionally characterized UPF0316 family proteins

  • Domain prediction using tools like Pfam, InterPro, and SMART

  • Assessment of conserved residues that might indicate functional sites

  • Genomic context analysis (neighboring genes often have related functions)

Studies of other S. aureus surface proteins have revealed diverse functions including adhesion to host tissues, immune evasion, and biofilm formation . Similar to SasG, which plays a crucial role in biofilm development, SAV1911 may have functions related to S. aureus persistence and virulence based on its predicted structural characteristics and expression patterns.

What molecular cloning strategies are most effective for recombinant expression of SAV1911?

Based on successful approaches used for other S. aureus proteins, the following molecular cloning strategy is recommended for SAV1911:

Table 1: Recommended Expression Systems for SAV1911

Expression SystemVectorHost StrainInduction ConditionsAdvantages
pET28a/bT7 promoter-basedE. coli Rosetta (DE3)0.5-1 mM IPTG, 37°C for 3-4hHigh yield, N/C-terminal His-tag
pMal-c5xPtac promoterE. coli DH10B0.3 mM IPTG, 25°C overnightEnhanced solubility with MBP fusion
pGEXtac promoterE. coli BL210.1-0.5 mM IPTG, 30°C for 4hGST fusion for solubility and purification

The cloning procedure should follow these steps:

  • PCR amplification of the SAV1911 gene using primers with engineered restriction sites (BamHI/SalI) similar to approaches used for SasG, proteinase SplB, and α-haemolysin

  • Restriction digestion and ligation into the selected expression vector

  • Transformation into an appropriate E. coli strain for plasmid propagation

  • Sequence verification of the construct

  • Expression optimization including temperature, IPTG concentration, and duration testing

If full-length protein expression is problematic, consider domain-based approaches as demonstrated for SasG, where separate constructs were created for domains A and B .

How can antibodies against SAV1911 be developed for functional studies?

Development of anti-SAV1911 antibodies would follow a methodology similar to that described for other S. aureus proteins:

  • Immunization approach:

    • Purify recombinant SAV1911 protein using affinity chromatography

    • Immunize rabbits or mice with 20-50 μg of protein per injection following a schedule of primary immunization and 3-4 boosters at 2-week intervals

    • For enhanced immunogenicity, consider formalin-inactivation of the protein as performed for α-haemolysin

  • Antibody validation:

    • Verify antibody specificity using Western blot against both recombinant protein and S. aureus lysates

    • Determine antibody titers using ELISA

    • Test for cross-reactivity with other S. aureus proteins

    • Confirm functional activity in appropriate assays

  • Functional applications:

    • Assess the ability of anti-SAV1911 antibodies to inhibit potential protein functions

    • Test antibody effects on biofilm formation using crystal violet staining methods as described for anti-SasG antibodies

    • Evaluate protective capacity in infection models if SAV1911 is confirmed as a virulence factor

What is the potential role of SAV1911 in S. aureus biofilm formation?

To investigate SAV1911's possible involvement in biofilm formation, researchers can apply methodologies similar to those used for studying SasG:

  • Biofilm inhibition assays:

    • Cultivate S. aureus overnight in appropriate media (Brain Heart Infusion/Yeast Extract)

    • Dilute the culture and dispense into 96-well plates

    • Add serial dilutions of anti-SAV1911 antibodies

    • Assess biofilm formation using 0.1% crystal violet staining and measurement at 560 nm

  • Comparative analysis:

    • Generate SAV1911 knockout strains

    • Compare biofilm-forming capacity between wild-type and mutant strains

    • Complement the knockout with recombinant SAV1911 to confirm specificity

    • Analyze biofilm architecture using confocal microscopy

  • Expression analysis during biofilm development:

    • Collect S. aureus cells at different stages of biofilm formation

    • Quantify SAV1911 expression using qRT-PCR

    • Compare expression levels between planktonic and biofilm growth conditions

The biofilm assay methodology outlined in the research on SasG provides a validated approach that can be directly applied to studying SAV1911's potential role .

How does host immune response target SAV1911 during S. aureus infection?

Understanding the immunogenicity of SAV1911 requires approaches similar to those that identified immunodominant S. aureus proteins:

  • Immunodominance assessment:

    • Analyze sera from patients with S. aureus infections for antibodies against SAV1911

    • Compare antibody titers against SAV1911 with those against known immunodominant proteins like α-haemolysin, proteinase SplB, and SasG

    • Determine if SAV1911 elicits strong antibody responses similar to these proteins

  • Host response characterization:

    • Analyze transcriptomic profiles of host tissues infected with wild-type versus SAV1911-deficient S. aureus strains

    • Identify differentially expressed immune-related genes using GO term enrichment analysis

    • Focus on pathways related to immune system processes and response to stimulus as identified in S. aureus infection models

  • Potential vaccine applications:

    • Evaluate whether anti-SAV1911 antibodies provide protection in animal infection models

    • Consider SAV1911 as a potential component in multi-valent vaccine formulations if it proves to be immunogenic and protective

Studies have shown that only a limited number of S. aureus proteins are highly immunogenic despite the bacterium producing numerous extracellular proteins . Determining whether SAV1911 belongs to this select group would provide insights into its importance during infection.

What purification strategies yield the highest quality recombinant SAV1911 protein?

Based on successful purification approaches for other S. aureus proteins, the following protocol is recommended:

Table 2: Purification Strategy for Recombinant SAV1911

Purification StepMethodBuffer ConditionsExpected Results
Initial captureNi-NTA affinity chromatography (for His-tagged protein)50 mM Tris-HCl, pH 7.4, 300 mM NaCl, 10-250 mM imidazole gradient>80% purity
Intermediate purificationIon exchange chromatography20 mM Tris-HCl, pH 8.0, 50-500 mM NaCl gradient>90% purity
PolishingSize exclusion chromatography20 mM Tris-HCl, pH 7.4, 150 mM NaCl>95% purity
Quality controlSDS-PAGE, Western blot, mass spectrometryN/AConfirmation of identity and purity

Additional considerations:

  • If the protein forms inclusion bodies (common with recombinant expression), develop a refolding protocol:

    • Solubilize inclusion bodies in 8M urea or 6M guanidine-HCl

    • Perform refolding by gradual dialysis against decreasing concentrations of denaturant

    • Verify proper folding using circular dichroism spectroscopy

  • For MBP-tagged constructs (similar to SasG fragments described in the research ):

    • Purify using amylose resin

    • Consider whether to cleave the MBP tag using Factor Xa protease

    • Further purify using additional chromatography steps if needed

  • Assess protein stability and optimize storage conditions:

    • Test stability at different temperatures (4°C, -20°C, -80°C)

    • Evaluate the effect of glycerol (10-20%) on long-term stability

    • Determine if lyophilization is appropriate for long-term storage

What gene knockout or silencing methods are most effective for studying SAV1911 function in S. aureus?

To investigate the function of SAV1911 through gene knockout or silencing, researchers can apply the following methodologies:

  • Allelic replacement strategy:

    • Design primers to amplify ~1kb flanking regions upstream and downstream of SAV1911

    • Clone these regions into a temperature-sensitive plasmid (e.g., pIMAY)

    • Introduce an antibiotic resistance marker between the flanking regions

    • Transform into S. aureus and select for double crossover events

    • Confirm deletion by PCR and sequencing

  • CRISPR-Cas9 approach:

    • Design sgRNAs targeting the SAV1911 coding sequence

    • Clone sgRNA into a CRISPR-Cas9 vector system optimized for S. aureus

    • Provide a repair template for homology-directed repair

    • Screen transformants for successful editing

    • Verify knockout by sequencing and protein expression analysis

  • Phenotypic characterization of mutants:

    • Compare growth characteristics under various conditions

    • Assess biofilm formation capacity using crystal violet staining methods

    • Evaluate virulence in appropriate infection models

    • Analyze transcriptomic changes resulting from SAV1911 deletion using RNA-Seq approaches similar to those described for S. aureus infection studies

The research methodologies described for studying other S. aureus factors provide a framework that can be adapted for SAV1911 functional investigations.

What transcriptomic approaches best characterize the differential expression of SAV1911 during infection?

RNA-Seq analysis provides the most comprehensive approach to characterize SAV1911 expression profiles during infection. Based on methodologies described for S. aureus gene expression studies:

  • Sample preparation:

    • Establish appropriate infection models (e.g., murine skin infection similar to that described in the research )

    • Isolate bacterial RNA from infected tissues using methods that minimize host RNA contamination

    • Prepare RNA-Seq libraries including rRNA depletion steps

    • Perform deep sequencing (>20 million reads per sample)

  • Data analysis:

    • Align reads to the S. aureus genome using appropriate tools (e.g., Bowtie2, STAR)

    • Normalize expression data and identify differentially expressed genes

    • Focus analysis on SAV1911 expression patterns

    • Compare expression in different infection sites and timepoints

  • Validation:

    • Confirm RNA-Seq findings with qRT-PCR using gene-specific primers

    • Use housekeeping genes like GAPDH as internal controls

    • Present fold-changes in expression relative to appropriate reference conditions

  • Functional implications:

    • Correlate SAV1911 expression patterns with specific infection stages

    • Identify co-expressed genes that might functionally interact with SAV1911

    • Look for regulatory elements that control SAV1911 expression

The transcriptomic approaches described for analyzing S. aureus gene expression during skin infection provide a validated methodology that can be directly applied to studying SAV1911 expression dynamics .

How can structure-function relationships of SAV1911 be experimentally determined?

To elucidate structure-function relationships of SAV1911, researchers can employ a multi-faceted approach:

  • Structural determination:

    • X-ray crystallography of purified SAV1911

    • NMR spectroscopy for solution structure and dynamics

    • Cryo-electron microscopy for larger complexes

    • Computational modeling using tools like AlphaFold

  • Functional domain mapping:

    • Generate truncated versions of SAV1911 similar to the domain-based approach used for SasG

    • Express and purify individual domains

    • Assess functional activities of each domain

    • Create domain-swapping chimeras to identify specific functional regions

  • Site-directed mutagenesis:

    • Identify conserved residues through multiple sequence alignment

    • Generate point mutations in potentially important residues

    • Express and purify mutant proteins

    • Perform functional assays to determine effects of mutations

  • Protein-protein interaction studies:

    • Identify binding partners using pull-down assays or yeast two-hybrid screens

    • Characterize binding interfaces using HDX-MS or crosslinking-MS

    • Determine binding affinities using SPR or ITC

    • Visualize complexes using structural biology techniques

These approaches parallel methodologies that have been successfully applied to other S. aureus proteins and would provide comprehensive insights into SAV1911 function.

What bioinformatic tools are most useful for predicting SAV1911 interactions and potential drug targeting sites?

Several bioinformatic approaches can help predict SAV1911 interactions and identify potential drug targets:

Table 3: Bioinformatic Tools for SAV1911 Analysis

Analysis TypeRecommended ToolsApplications for SAV1911
Sequence analysisBLAST, Clustal Omega, HMMERIdentify homologs, conserved domains, evolutionary relationships
Structural predictionAlphaFold, I-TASSER, SWISS-MODELGenerate 3D structural models for SAV1911
Binding site predictionCASTp, SiteMap, FTSiteIdentify potential ligand-binding pockets
Protein-protein interactionSTRING, STITCH, IntActPredict functional associations with other proteins
Molecular dockingAutoDock Vina, HADDOCK, GlideScreen virtual compound libraries for potential inhibitors
Druggability assessmentDogSiteScorer, PockDrug, DrugScorePPIEvaluate potential druggable sites

Implementation strategy:

  • Start with basic sequence analysis to place SAV1911 in evolutionary context

  • Generate structural models and validate them using quality assessment tools

  • Identify potential functional sites based on conservation and structural features

  • Perform virtual screening against these sites to identify candidate inhibitors

  • Validate predictions experimentally using methods described in previous sections

Similar bioinformatic approaches have guided research on other S. aureus virulence factors and could significantly accelerate the functional characterization of SAV1911 and its potential as a drug target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.