Recombinant Staphylococcus aureus UPF0344 protein MW0851 (MW0851)

Shipped with Ice Packs
In Stock

Description

Definition and Classification

Recombinant Staphylococcus aureus UPF0344 protein MW0851 (MW0851) is classified as a member of the uncharacterized protein family (UPF) 0344. The designation "UPF" indicates that the precise biological function of this protein has not been fully characterized through experimental validation. The protein is identified in databases by its UniProt accession number Q7A1B5 .

The MW0851 designation refers to its locus tag in the Staphylococcus aureus strain MW2 genome, indicating it was the 851st open reading frame identified on the main chromosome of this particular bacterial strain. As a recombinant protein, it is produced through genetic engineering techniques that allow for the expression of the Staphylococcus aureus gene in a heterologous host system, typically Escherichia coli .

Origin and Source Organism

The native form of this protein originates from Staphylococcus aureus strain MW2, a clinically significant bacterial pathogen. Staphylococcus aureus is a gram-positive, spherically shaped bacterium commonly found as part of the normal microbiota of the human body, particularly in the upper respiratory tract and on the skin . Approximately 30% of healthy adults carry S. aureus in their nose (usually temporarily) and about 20% harbor the bacteria on their skin .

While often existing as a commensal organism, Staphylococcus aureus can also act as an opportunistic pathogen, causing a range of infections from minor skin conditions to life-threatening diseases such as pneumonia, meningitis, osteomyelitis, endocarditis, toxic shock syndrome, and sepsis . The bacteria can spread through direct contact with infected individuals, contaminated objects, or by inhaling infected droplets dispersed by sneezing or coughing .

Physical and Chemical Properties

Based on information from commercial suppliers, the recombinant MW0851 protein possesses the following physical and chemical properties:

PropertySpecificationReference
Protein LengthFull Length (1-129 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
Expression SystemE. coli
Tag TypesHis-tag (N-terminal in some preparations)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
StabilitySensitive to repeated freeze-thaw cycles

The physical properties of commercially available MW0851 may be influenced by the tags added during the recombinant production process, such as the histidine (His) tag mentioned in some product descriptions .

Recombinant Expression Systems

The recombinant MW0851 protein is typically produced using Escherichia coli as the expression host . This bacterial expression system is widely used for producing recombinant proteins due to its rapid growth, well-characterized genetics, and relatively simple cultivation requirements.

In commercial production, the coding sequence for MW0851 (amino acids 1-129) is cloned into an expression vector that incorporates a tag—such as a histidine tag—to facilitate purification. The expressed protein is then isolated from the bacterial culture using affinity chromatography and other purification techniques to achieve high purity levels (>90%) reported by suppliers .

The expression region typically encompasses the full protein length (residues 1-129), ensuring that the complete protein structure is represented in the recombinant product .

Reconstitution Guidelines

The lyophilized protein should be reconstituted following specific guidelines to ensure optimal activity and stability:

  1. Centrifuge the vial briefly before opening to bring the contents to the bottom

  2. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. For long-term storage of reconstituted protein, the addition of glycerol to a final concentration of 5-50% is recommended

  4. One supplier specifically recommends a final glycerol concentration of 50% as their default

The storage buffer typically consists of a Tris/PBS-based formulation containing 6% trehalose at pH 8.0, optimized to maintain the protein in a stable state . These specific formulation components likely play roles in preventing protein aggregation and maintaining structural integrity during the freeze-thaw process.

Role in Staphylococcus aureus

The specific biological function of the UPF0344 protein MW0851 in Staphylococcus aureus remains largely uncharacterized based on the available search results. As a member of an uncharacterized protein family (UPF), its precise role in bacterial physiology, pathogenesis, or survival has not been definitively established through experimental validation.

The amino acid sequence characteristics, particularly its hydrophobic regions, suggest it may function as a membrane-associated protein. This is consistent with many bacterial proteins that play critical roles in membrane integrity, transport processes, or signaling pathways.

Research Applications and Future Directions

While the specific research applications of recombinant MW0851 protein are not explicitly detailed in the available literature, its commercial availability suggests it holds value in laboratory investigations. Potential research applications may include:

  1. Structural studies to determine the three-dimensional configuration of this uncharacterized protein

  2. Functional assays to elucidate its biological role in Staphylococcus aureus

  3. Development of antibodies against this protein for detection or localization studies

  4. Investigation of potential interactions with other bacterial or host proteins

  5. Exploration of its possible role in bacterial pathogenesis or survival under stress conditions

The commercial availability of this protein from multiple suppliers, with prices reaching over $2,600 for certain preparations , indicates there is research demand for this reagent. This demand may reflect ongoing investigations into the S. aureus proteome and efforts to understand the functions of previously uncharacterized proteins.

Further research into MW0851 could contribute to a more comprehensive understanding of S. aureus biology, potentially informing new approaches to addressing infections caused by this significant human pathogen. As S. aureus remains a major cause of hospital-acquired infections and is associated with up to 50,000 deaths annually in the United States alone , expanded knowledge of its proteome, including uncharacterized proteins like MW0851, may prove valuable in developing novel therapeutic strategies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with blue ice packs by default. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted according to your needs.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MW0851; UPF0344 protein MW0851
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Staphylococcus aureus (strain MW2)
Target Names
MW0851
Target Protein Sequence
MLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFMLLTLISGFWILIQSFM NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHKMFWITMALIIITMVLGVILPLG PISKLFGIG
Uniprot No.

Target Background

Database Links

KEGG: sam:MW0851

Protein Families
UPF0344 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Staphylococcus aureus UPF0344 protein MW0851?

Recombinant Staphylococcus aureus UPF0344 protein MW0851 is a full-length protein derived from S. aureus strain MW2, with UniProt accession number Q7A1B5. The protein consists of 129 amino acids with the expression region spanning positions 1-129. The amino acid sequence includes a series of hydrophobic and hydrophilic regions: mLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFmLLTLISGFWILIQSFMNGGANHmLLTLKmLCGVAVVGLMEVSIAKRKRHEQSHKMFWITMALIIITMVLGVILPLGPISKLFGIG. This protein belongs to the UPF0344 family, which contains proteins of unknown function, making it a subject of interest for functional characterization studies .

What are the optimal storage conditions for UPF0344 protein MW0851?

The optimal storage conditions for maintaining the stability and activity of recombinant UPF0344 protein MW0851 involve multiple considerations. The protein should be stored in a Tris-based buffer containing 50% glycerol, which has been optimized specifically for this protein. For short-term storage, maintain the protein at -20°C. For extended preservation periods, storage at either -20°C or -80°C is recommended. To prevent protein degradation, repeated freeze-thaw cycles should be strictly avoided. When actively working with the protein, prepare smaller working aliquots that can be stored at 4°C for a maximum period of one week to maintain structural integrity and biological activity .

What is the structural composition of Staphylococcus aureus cell wall and how does it relate to protein expression?

The cell wall of Staphylococcus aureus features a distinctive composition of approximately 90% peptidoglycan and 10% teichoic acid. This dense peptidoglycan network structure is significantly more compact than that found in Gram-negative bacteria, which directly impacts its protein expression and extraction methodologies. This structural feature explains why S. aureus retains crystal violet during Gram staining, appearing purple as the dye remains attached despite alcohol washing. The thickness and unique architecture of the peptidoglycan layer also influences the bacterium's susceptibility to antibiotics, particularly beta-lactams like penicillin, which target cell wall synthesis. When expressing recombinant proteins from S. aureus, including UPF0344 protein MW0851, researchers must consider these structural characteristics when designing cell lysis and protein purification protocols .

What are the challenges in studying the function of UPF0344 family proteins like MW0851?

Investigating the function of UPF0344 family proteins such as MW0851 presents several methodological challenges. The primary obstacle stems from the limited prior characterization of this protein family, which necessitates a multi-faceted research approach. Researchers should implement a comprehensive strategy that combines:

  • Sequence-based computational analysis using tools such as BLAST, Pfam, and structural prediction algorithms to identify potential functional domains and evolutionary relationships

  • Protein-protein interaction studies using pull-down assays, yeast two-hybrid systems, or proximity labeling techniques to identify binding partners

  • Gene knockout or CRISPR-based gene editing studies to assess phenotypic changes in S. aureus

  • Heterologous expression systems to produce sufficient quantities of the protein for structural studies

  • Comparative genomics across different S. aureus strains to identify conserved regions indicating functional importance

The hydrophobic regions in the MW0851 amino acid sequence (evident in the stretches of hydrophobic residues) suggest possible membrane association, which introduces additional technical challenges for solubilization and purification while maintaining native conformation .

How can single-case experimental designs be applied to study UPF0344 protein MW0851 function?

Single-case experimental designs (SCEDs) can be effectively adapted for molecular biology research focused on UPF0344 protein MW0851 through carefully structured reversal designs. When investigating this protein's function or interactions, researchers can implement an A₁B₁A₂B₂ design where:

  • Phase A₁: Baseline measurements of cellular processes (e.g., membrane permeability, cell signaling) without MW0851 protein manipulation

  • Phase B₁: Introduction of recombinant MW0851 at a specific concentration

  • Phase A₂: Return to baseline conditions through protein depletion or inhibition

  • Phase B₂: Reintroduction of MW0851 to confirm reproducibility of observed effects

This approach requires establishing stable baseline measurements with minimal variability (staying within 15% of median values) and collecting a minimum of 5 data points per phase. The experimental design must account for the protein's half-life and potential persistence of effects, incorporating appropriate washout periods between phases. For more complex investigations, researchers can compare different concentrations of MW0851 using designs such as A₁B₁C₁B₂C₂, where B and C represent different protein concentrations. This methodology enables researchers to establish causal relationships between MW0851 and observed cellular phenotypes with greater confidence than traditional group designs, particularly when studying concentration-dependent effects .

What are the considerations for designing experiments involving MW0851 interaction with host immune factors?

Designing experiments to investigate MW0851 interactions with host immune factors requires a multifaceted approach that integrates both in vitro and ex vivo systems. A comprehensive experimental design should include:

  • Variable identification and control:

    • Independent variables: Concentration of MW0851, exposure time, immune cell types

    • Dependent variables: Cytokine production, cell surface marker expression, phagocytic activity

    • Controlled variables: Temperature, pH, culture medium composition, cell densities

  • Systematic manipulation protocols:

    • Dose-response studies (0.1-100 μg/mL of recombinant MW0851)

    • Time-course experiments (30 minutes to 72 hours)

    • Co-culture systems with varied immune cell populations

  • Hypothesis formulation:

    • Null hypothesis (H₀): "MW0851 protein does not alter cytokine production in human macrophages"

    • Alternative hypothesis (H₁): "MW0851 protein significantly modifies pro-inflammatory cytokine production in human macrophages in a dose-dependent manner"

The experimental design should incorporate appropriate controls, including heat-inactivated protein, related but functionally distinct S. aureus proteins, and vehicle controls. When studying interactions with various immune cell types, randomization and blinding procedures should be implemented to minimize experimental bias. Given the potential for batch effects with recombinant proteins, multiple protein preparations should be tested to ensure reproducibility of results .

What is the optimal protocol for purifying recombinant UPF0344 protein MW0851?

The optimal purification protocol for recombinant UPF0344 protein MW0851 requires a strategic multi-step approach due to its hydrophobic regions and potential membrane association. The following methodological workflow maximizes yield while maintaining protein integrity:

  • Expression system selection: Based on the protein's characteristics, E. coli BL21(DE3) with a pET vector system containing an N-terminal His-tag is recommended for initial expression trials. Alternative systems including cell-free expression should be considered if membrane association causes toxicity issues.

  • Cell lysis optimization:

    • Buffer composition: 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, 1% Triton X-100, 1 mM PMSF, and protease inhibitor cocktail

    • Sonication parameters: 6 cycles of 10-second pulses at 60% amplitude with 30-second cooling intervals on ice

  • Purification workflow:

    • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Intermediate purification: Size exclusion chromatography using Superdex 75

    • Polishing step: Ion exchange chromatography if necessary

  • Critical quality assessment:

    • Purity: SDS-PAGE (target >95%)

    • Identity: Western blot and mass spectrometry

    • Activity: Functional assays based on predicted protein function

  • Storage preparation:

    • Buffer exchange to optimal storage buffer (Tris-based buffer with 50% glycerol)

    • Concentration determination (Bradford assay)

    • Aliquoting (50 μL per tube) and flash freezing

This protocol typically yields 3-5 mg of purified protein per liter of bacterial culture with >90% purity. Each purification batch should be validated using analytical SEC to confirm the absence of aggregates and consistent monodispersity .

How should researchers address data that contradicts initial hypotheses about MW0851 function?

When confronted with experimental data that contradicts initial hypotheses about MW0851 function, researchers should implement a systematic approach to validate findings and explore alternative explanations. The following methodological framework provides a structured path forward:

  • Data validation phase:

    • Repeat experiments with increased technical and biological replicates

    • Implement alternative methodologies to confirm observations

    • Review experimental controls and validate reagents (especially antibody specificity)

    • Assess statistical power and appropriateness of statistical tests

  • Hypothesis reassessment:

    • Critically reexamine initial assumptions about protein function

    • Review the literature for similar proteins with unexpected functions

    • Consider potential post-translational modifications or alternative structural conformations

  • Experimental redesign strategy:

    • Expand concentration ranges and time points to capture nonlinear or temporal effects

    • Introduce orthogonal assays that measure related but distinct parameters

    • Consider environmental conditions that might influence protein behavior (pH, ionic strength, presence of cofactors)

  • Advanced investigation techniques:

    • Implement site-directed mutagenesis to identify critical functional residues

    • Utilize hydrogen-deuterium exchange mass spectrometry to assess structural dynamics

    • Employ cellular localization studies to determine if compartmentalization affects function

  • Transparent reporting:

    • Document both supportive and contradictory data

    • Present alternative interpretations of results

    • Identify limitations of experimental approaches

This methodological framework transforms unexpected results into opportunities for deeper understanding of MW0851's biological role, potentially leading to novel discoveries about this poorly characterized protein family .

What are the key considerations for designing reversal experiments with MW0851 protein?

Designing effective reversal experiments with MW0851 protein requires meticulous planning to establish robust cause-effect relationships. The following methodological considerations are critical:

  • Phase duration planning:

    • Baseline phase (A): Minimum 5 data points with demonstrated stability (variability within 15% of median)

    • Intervention phase (B): Sufficient duration to observe full effect development (typically 5-7 data points)

    • Return-to-baseline phase (A₂): Duration depends on protein half-life and effect persistence

    • Reintroduction phase (B₂): Matches B₁ duration to assess reproducibility

  • Stability assessment metrics:

    • Level stability: Consistent magnitude of measured variables

    • Trend stability: Absence of systematic increases/decreases

    • Variability stability: Consistent degree of fluctuation around central tendency

  • Washout period determination:

    • Calculate based on protein half-life (minimum 3-5 half-lives)

    • Verify complete clearance through sensitive detection methods

    • Monitor return of dependent variables to baseline values

  • Experimental control mechanisms:

    • Internal control: Each subject serves as their own control

    • Replication control: Minimum three replications of treatment effects

    • Sequential introduction: Staggered implementation for multiple subjects/systems

  • Reversal limitations assessment:

    • Evaluate carryover effects and potential irreversibility

    • Identify ethical constraints (particularly for in vivo applications)

    • Assess practical feasibility of complete reversal

PhaseMinimum DurationStability CriteriaData Collection Frequency
A₁ (Baseline)5 data points±15% of medianDaily or per experimental unit
B₁ (Treatment)5-7 data pointsN/ASame as baseline
A₂ (Reversal)5 data points + washoutReturn to ±20% of A₁Same as baseline
B₂ (Reintroduction)5-7 data pointsN/ASame as baseline

This methodological approach is particularly valuable for establishing whether MW0851 has immediate effects on cellular processes or if longer exposure periods are required to observe phenotypic changes .

What statistical approaches are most appropriate for analyzing dose-response data for MW0851?

The analysis of dose-response data for MW0851 protein requires sophisticated statistical approaches that account for the complex biological systems involved. A comprehensive analytical framework should incorporate:

  • Exploratory data analysis:

    • Box plots and scatter plots to visualize response distributions across concentrations

    • Residual analysis to assess normality and homoscedasticity assumptions

    • Identification of potential outliers using Cook's distance and leverage metrics

  • Dose-response modeling options:

    • Four-parameter logistic regression (4PL) for standard sigmoidal responses

    • Five-parameter logistic regression (5PL) when asymmetry is observed

    • Biphasic models for hormetic or bell-shaped responses that might occur with MW0851

  • Comparison metrics:

    • EC₅₀/IC₅₀ values with 95% confidence intervals

    • Hill slopes to characterize response steepness

    • Maximum efficacy parameters (Emax) across experimental conditions

  • Statistical inference approaches:

    • ANOVA with post-hoc Dunnett's test for comparing multiple concentrations to control

    • Mixed-effects models for repeated measures designs

    • Bootstrapping for robust parameter estimation when distributional assumptions are violated

  • Model selection criteria:

    • Akaike Information Criterion (AIC) and Bayesian Information Criterion (BIC)

    • F-test for nested models

    • Visual assessment of fit quality through residual plots

For complex experiments examining MW0851 effects across multiple cell types or conditions, researchers should implement multivariate approaches such as principal component analysis or hierarchical clustering to identify patterns of response. Power analysis should be conducted a priori, typically aiming for 80% power to detect a 25% change in primary endpoints with alpha set at 0.05 .

How can researchers effectively visualize and interpret experimental data related to MW0851 function?

Effective visualization and interpretation of experimental data related to MW0851 function requires thoughtful selection of graphical representations that accurately convey biological significance while facilitating pattern recognition. A comprehensive visualization strategy should include:

  • Temporal and dynamic data:

    • Line graphs with error bands (rather than error bars) to represent continuous processes

    • Heat maps for time-course experiments showing multiple parameters

    • Phase portraits for visualizing system dynamics when studying protein interactions

  • Comparative analyses:

    • Forest plots for displaying effect sizes across different experimental conditions

    • Radar charts for multiparameter comparisons of MW0851 effects versus control proteins

    • Violin plots to show full distribution characteristics beyond simple means

  • Structural and interaction data:

    • Network diagrams for protein-protein interaction studies

    • Domain mapping visualizations highlighting functional regions

    • Structure-activity relationship matrices when comparing MW0851 mutants

  • Integration of multiple data types:

    • Correlation matrices with hierarchical clustering

    • Principal component biplots to visualize relationships between samples and variables

    • Sankey diagrams for pathway analysis results

  • Interpretation frameworks:

    • Establish clear visual encoding principles (consistent color schemes, shapes)

    • Implement visual benchmarking against known controls

    • Create visual abstracts summarizing key findings

For example, when analyzing dose-dependent effects of MW0851 on cytokine production in different cell types, a faceted heat map approach would effectively display concentration on the x-axis, cytokine types on the y-axis, with separate facets for each cell type, using color intensity to represent fold change compared to control conditions. This approach enables identification of cell-specific responses and concentration thresholds for different cytokines in a single visualization .

What approaches should be used to integrate multiple experimental datasets when characterizing MW0851?

Integrating multiple experimental datasets for comprehensive characterization of MW0851 requires sophisticated computational approaches that maintain data integrity while revealing emergent patterns. A methodical integration framework should encompass:

  • Data harmonization protocols:

    • Standardization procedures to normalize measurements across platforms

    • Batch effect correction using ComBat or similar algorithms

    • Missing data imputation through multiple imputation by chained equations (MICE)

  • Multi-omics integration strategies:

    • Canonical correlation analysis (CCA) for identifying relationships between data types

    • Similarity network fusion (SNF) to create integrated networks

    • Multi-block partial least squares (MB-PLS) for modeling relationships between datasets

  • Functional interpretation methods:

    • Gene set enrichment analysis (GSEA) for transcriptomic responses to MW0851

    • Protein interaction network analysis using STRING or IntAct databases

    • Pathway impact analysis incorporating both magnitude and topology

  • Systems-level modeling approaches:

    • Bayesian networks to infer causal relationships

    • Ordinary differential equation (ODE) models for dynamic processes

    • Agent-based models for complex cellular responses

  • Validation frameworks:

    • Cross-validation strategies for predictive models

    • Independent dataset validation when available

    • Sensitivity analysis to assess robustness of findings

Data Integration LevelAppropriate MethodsComputational ComplexitySoftware Tools
Metadata integrationData concatenation, Joint clusteringLowR (dplyr, tidyr)
Statistical integrationCCA, PLS, MOFAMediumR (mixOmics, MOFA)
Network integrationSNF, Weighted correlation networksMedium-HighR (SNFtool, WGCNA)
Model-based integrationBayesian networks, ODE systemsHighPython (PyMC3, SciPy)

This systematic approach to data integration enables researchers to move beyond reductionist analyses of individual experiments to develop comprehensive models of MW0851 function within cellular contexts. The integration of structural data with functional assays is particularly valuable for this poorly characterized protein, potentially revealing structure-function relationships that inform future targeted studies .

What are promising research avenues for elucidating the functional role of UPF0344 protein MW0851 in S. aureus pathogenicity?

Several promising research avenues could significantly advance our understanding of UPF0344 protein MW0851's role in S. aureus pathogenicity. Methodological approaches should include:

  • Comparative virulence studies:

    • Generate MW0851 knockout mutants using allelic replacement techniques

    • Assess virulence in multiple infection models (invertebrate and mammalian)

    • Conduct complementation studies to confirm phenotypes

    • Implement competitive infection assays (wild-type vs. knockout)

  • Host-pathogen interaction analyses:

    • Examine MW0851 expression during different infection stages

    • Investigate protein localization during host cell interaction

    • Assess impact on immune signaling pathways

    • Evaluate contribution to biofilm formation and persistence

  • Structural biology approaches:

    • Determine high-resolution crystal or cryo-EM structure

    • Perform molecular dynamics simulations to identify functional domains

    • Conduct structure-guided mutagenesis of predicted active sites

    • Implement hydrogen-deuterium exchange mass spectrometry to identify conformational changes

  • System-wide impact assessment:

    • Apply RNA-Seq to characterize transcriptomic changes in knockout strains

    • Conduct proteomics analysis to identify compensatory protein expression

    • Implement metabolomics to detect altered metabolic profiles

    • Develop network models integrating multi-omics data

These methodological approaches should be implemented across multiple S. aureus clinical isolates to account for strain variability and ensure broad applicability of findings. The integration of results from these complementary research directions will provide a comprehensive understanding of MW0851's role in S. aureus pathobiology and potential as a therapeutic target .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.