Recombinant Staphylococcus aureus UPF0344 protein NWMN_0840 (NWMN_0840)

Shipped with Ice Packs
In Stock

Description

Key Features of NWMN_0840

PropertyDetails
SourceStaphylococcus aureus (recombinant expression in E. coli)
TagN-terminal His tag for affinity chromatography purification
Protein LengthFull-length (1-129 amino acids)
FormLyophilized powder
Purity>90% (determined by SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized water (0.1-1.0 mg/mL); glycerol (5-50%) recommended for stability

Amino Acid Sequence

The protein sequence includes motifs such as MLHLHILSWVLAIILFIATYLNISKNQGRSPFFKPLHMILRLFMLLTLISGFWILIQSFMNGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHTMFWITIALIIITMVLGVILPLGPISKLFGIG, as derived from UniProt annotations .

Gene Annotation

  • Official Full Name: NWMN_0840

  • Synonyms: UPF0344 protein NWMN_0840

  • UniProt ID: A6QFI0

  • Pathway Involvement: While annotated in pathways (e.g., bacterial stress responses, virulence regulation), specific roles remain uncharacterized .

Protein Function

NWMN_0840 belongs to the UPF0344 family, a group of uncharacterized bacterial proteins. Limited functional data exist, but its expression in S. aureus suggests potential involvement in:

  • Pathogen-host interactions (e.g., immune evasion, adhesion).

  • Metabolic or regulatory pathways pending experimental validation .

Experimental Uses

ApplicationDetails
Vaccine DevelopmentPotential antigen for S. aureus vaccine candidates (analogous to SpA, α-toxin)
Protein Interaction StudiesAnalysis of binding partners via pull-down assays or yeast two-hybrid
Structural BiologyCrystallization for 3D structure determination (His tag facilitates purification)

Challenges

  • Low Functional Characterization: Unlike well-studied S. aureus proteins (e.g., α-toxin, SpA), NWMN_0840 lacks documented immune modulation or enzymatic activity .

  • Limited Clinical Data: No direct studies link NWMN_0840 to S. aureus pathogenesis or human immunity .

Critical Protocols

ParameterGuidelines
Storage-20°C/-80°C upon receipt; avoid repeated freeze-thaw cycles
ReconstitutionAliquot in sterile deionized water; add 5-50% glycerol for long-term storage
StabilityWorking aliquots stable at 4°C for ≤1 week

Unresolved Questions

  1. Functional Role: Does NWMN_0840 contribute to S. aureus virulence or survival in host environments?

  2. Immunogenicity: Can it elicit protective immune responses akin to CgoX or TPI in vaccine models ?

  3. Structural Insights: Does its 3D structure reveal functional motifs (e.g., enzymatic domains)?

Research Priorities

  • Knockout Studies: Generate ΔNWMN_0840 mutants to assess virulence in murine models.

  • Epitope Mapping: Identify immunogenic regions for vaccine design.

  • Proteomic Interactions: Screen for host or bacterial binding partners.

**Comparative Overview with Related S. aureus Proteins

ProteinFunctionVaccine Relevance
NWMN_0840Undefined (UPF0344 family)Theoretical (requires validation)
α-Toxin (Hla)Pore-forming toxin; immune modulation Target in glycoconjugate vaccines
SpAIgG-binding protein; immune evasion Neutralization by anti-SpA mAbs
CgoX/TPIHeme synthesis, glycolysis; vaccine targets Elicits protective antibodies

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in our inventory. However, if you have a specific format preference, kindly indicate your requirement in the order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
NWMN_0840; UPF0344 protein NWMN_0840
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Staphylococcus aureus (strain Newman)
Target Names
NWMN_0840
Target Protein Sequence
MLHLHILSWVLAIILFIATYLNISKNQGRSPFFKPLHMILRLFMLLTLISGFWILIQSFM NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHTMFWITIALIIITMVLGVILPLG PISKLFGIG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0344 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the predicted structural domains in NWMN_0840 protein?

Based on sequence analysis, NWMN_0840 belongs to the UPF0344 protein family and contains multiple transmembrane helices. The protein has a characteristic hydrophobicity pattern with alternating hydrophobic and hydrophilic regions. The N-terminal region (residues 1-20) contains a conserved signal sequence typical of membrane-integrated proteins, while the C-terminal region (approximately residues 100-129) appears to have a more hydrophilic character, potentially functioning in protein-protein interactions or substrate binding. This structural arrangement is consistent with its predicted localization to the bacterial cell membrane .

What is the recommended expression system for NWMN_0840 protein?

The commercially available Recombinant Staphylococcus aureus UPF0344 protein NWMN_0840 is expressed in E. coli expression systems. For optimal expression, using BL21(DE3) E. coli strains with pET-based vectors is recommended, as these systems provide tight control of protein expression through IPTG induction. When designing your expression protocol, consider the following parameters:

  • Induction temperature: 16-18°C for overnight expression to reduce inclusion body formation

  • IPTG concentration: 0.1-0.5 mM (optimize for your specific construct)

  • Media: Terrific Broth (TB) or 2xYT for higher yield

  • OD600 at induction: 0.6-0.8 for optimal balance between cell density and expression efficiency

As a membrane protein, NWMN_0840 may present solubility challenges, so expression conditions may need optimization to balance yield and proper folding .

What purification strategy should be employed for NWMN_0840 protein?

Since NWMN_0840 is typically produced with an N-terminal His tag, immobilized metal affinity chromatography (IMAC) is the recommended first purification step. A methodological approach should include:

  • Cell lysis using either sonication or high-pressure homogenization in a buffer containing:

    • 50 mM Tris-HCl, pH 8.0

    • 300 mM NaCl

    • 10 mM imidazole

    • 1% appropriate detergent (e.g., n-Dodecyl β-D-maltoside)

    • Protease inhibitors

  • IMAC purification using Ni-NTA or Co-based resins with:

    • Binding: 20 mM imidazole

    • Washing: 40-60 mM imidazole

    • Elution: 250-300 mM imidazole gradient

  • Size-exclusion chromatography as a polishing step in a buffer containing:

    • 20 mM Tris-HCl, pH 7.5

    • 150 mM NaCl

    • 0.03-0.05% detergent

The final purity should exceed 90% as determined by SDS-PAGE analysis .

What are the optimal storage conditions for NWMN_0840 protein?

The recombinant NWMN_0840 protein requires specific storage conditions to maintain stability and activity. For long-term storage, the protein should be stored at -20°C to -80°C, with -80°C being preferable for extended periods. The protein is typically supplied as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. After reconstitution, it is recommended to add glycerol to a final concentration of 50% to prevent freeze-thaw damage. Working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and loss of activity .

How should NWMN_0840 protein be reconstituted for experimental use?

For optimal reconstitution of lyophilized NWMN_0840 protein, follow this methodological approach:

  • Briefly centrifuge the vial containing lyophilized protein to ensure all material is at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Gently mix by swirling or slow pipetting to avoid protein denaturation (do not vortex)

  • Add glycerol to a final concentration of 50% for cryoprotection

  • Aliquot the reconstituted protein into smaller volumes based on experimental needs

  • Flash-freeze aliquots in liquid nitrogen before transferring to -80°C storage

The reconstitution buffer should be Tris/PBS-based with pH 8.0 and may include 6% trehalose as a stabilizing agent. For membrane protein studies, consider adding a mild detergent at concentrations just above its critical micelle concentration (CMC) to maintain protein solubility without causing denaturation .

What controls should be included when working with NWMN_0840 protein in functional assays?

When designing experiments involving NWMN_0840 protein, proper controls are essential for result validation. A comprehensive experimental design should include:

  • Negative controls:

    • Buffer-only conditions (no protein)

    • Heat-denatured NWMN_0840 protein

    • Unrelated protein with similar size/tag system

  • Positive controls:

    • Known functional membrane protein from S. aureus

    • Previously validated batch of NWMN_0840 (if available)

  • Tag controls:

    • His-tagged control protein to account for tag interference

    • If possible, both tagged and untagged versions of NWMN_0840

  • Concentration gradient:

    • Multiple concentrations of NWMN_0840 to establish dose-response relationships

These controls allow for robust statistical analysis and help distinguish specific protein effects from experimental artifacts. For membrane protein studies, especially consider controls that account for detergent effects or reconstitution variability .

How should researchers design experiments to investigate NWMN_0840 membrane localization?

To investigate the membrane localization and topology of NWMN_0840, a multi-faceted experimental approach is recommended:

  • Subcellular fractionation:

    • Separate cytoplasmic, periplasmic, and membrane fractions

    • Analyze by Western blot with anti-His antibodies

    • Include known marker proteins for each fraction as controls

  • Fluorescence microscopy:

    • Create GFP/mCherry fusion constructs with NWMN_0840

    • Express in appropriate bacterial systems

    • Co-localize with membrane-specific dyes

  • Protease accessibility assays:

    • Create inside-out and right-side-out membrane vesicles

    • Treat with proteases and analyze protected fragments

    • Map the orientation of domains relative to the membrane

  • Cryo-electron microscopy:

    • For high-resolution structural information in membrane context

    • Use reconstituted protein in nanodiscs or liposomes

This comprehensive approach provides complementary data that collectively reveals the true membrane topology of NWMN_0840 protein .

What spectroscopic methods are most suitable for studying NWMN_0840 secondary structure?

For detailed characterization of NWMN_0840 secondary structure, multiple complementary spectroscopic techniques should be employed:

  • Circular Dichroism (CD) Spectroscopy:

    • Far-UV CD (190-250 nm) to quantify α-helical, β-sheet, and random coil content

    • Near-UV CD (250-350 nm) to probe tertiary structure

    • Thermal melting experiments to assess stability

    • Buffer considerations: low chloride concentration, detergents without chiral centers

  • Fourier Transform Infrared Spectroscopy (FTIR):

    • Particularly valuable for membrane proteins

    • Amide I region (1600-1700 cm⁻¹) analysis for secondary structure composition

    • Can be performed in various membrane mimetics

  • Nuclear Magnetic Resonance (NMR):

    • HSQC experiments to analyze protein fold integrity

    • TOCSY and NOESY for detailed structural information

    • Requires ¹⁵N/¹³C labeled protein for detailed analysis

A combined approach using these techniques provides a comprehensive view of NWMN_0840 structure in different environments and can reveal conformational changes upon substrate binding or environmental perturbations.

How can researchers investigate potential protein-protein interactions involving NWMN_0840?

To systematically characterize protein-protein interactions involving NWMN_0840, employ these methodological approaches:

  • Pull-down assays and co-immunoprecipitation:

    • Utilize the His-tag for affinity capture

    • Cross-linking prior to lysis can capture transient interactions

    • Mass spectrometry identification of binding partners

  • Surface Plasmon Resonance (SPR):

    • Immobilize NWMN_0840 on sensor chip via His-tag

    • Flow potential partners over the surface

    • Determine binding kinetics (kon, koff) and affinity (KD)

  • Microscale Thermophoresis (MST):

    • Fluorescently label NWMN_0840

    • Titrate unlabeled potential binding partners

    • Analyze thermophoretic mobility changes

  • Bacterial Two-Hybrid System:

    • Create fusion constructs with split reporter domains

    • Co-express in bacterial system

    • Screen for interaction-dependent reporter activation

  • Blue Native PAGE:

    • Particularly useful for membrane protein complexes

    • Preserves native protein interactions during separation

    • Western blot analysis to identify complex components

For each method, proper controls must be included to distinguish specific from non-specific interactions. The complementary nature of these techniques provides validation across different experimental conditions.

What approaches can be used to determine the physiological function of NWMN_0840?

Determining the physiological function of NWMN_0840, which currently has an uncharacterized function (UPF designation), requires a systematic multi-faceted approach:

  • Genetic approaches:

    • Generate knockout/knockdown strains in S. aureus

    • Perform phenotypic characterization under various growth conditions

    • Complementation studies with wild-type and mutant versions

    • Fitness assessment in competitive growth assays

  • Transcriptomic analysis:

    • RNA-seq comparison between wild-type and NWMN_0840 mutant strains

    • Identify differentially expressed genes and pathways

    • Condition-dependent expression profiling

  • Protein localization and trafficking:

    • Fluorescent protein fusions to track subcellular localization

    • Co-localization with known membrane components

    • Membrane fractionation and proteomic analysis

  • Computational predictions:

    • Homology modeling based on structurally characterized proteins

    • Molecular dynamics simulations in membrane environment

    • Virtual screening for potential substrates or binding partners

  • Metabolomic profiling:

    • Compare metabolite profiles between wild-type and mutant strains

    • Isotope labeling to track potential substrate transformations

    • Targeted assays based on computational predictions

This integrated approach maximizes the likelihood of identifying the true physiological function of this uncharacterized protein.

How can researchers assess the membrane integration and topology of NWMN_0840?

To experimentally determine the membrane integration and topology of NWMN_0840, employ the following methodological approaches:

  • Cysteine scanning mutagenesis:

    • Create a cysteine-free version of NWMN_0840

    • Introduce single cysteines at strategic positions

    • Label with membrane-impermeable thiol-reactive probes

    • Accessibility pattern reveals membrane-spanning regions

  • Proteolytic mapping:

    • Create membrane vesicles with defined orientation

    • Limited proteolysis with proteases like trypsin or chymotrypsin

    • Mass spectrometry analysis of protected fragments

    • Compare results between right-side-out and inside-out vesicles

  • Fluorescence quenching:

    • Introduce fluorescent labels at specific positions

    • Measure accessibility to water-soluble and membrane-embedded quenchers

    • Reconstruct topology from quenching patterns

  • Glycosylation mapping:

    • Introduce glycosylation sites at strategic positions

    • Express in a glycosylation-competent system

    • Assess glycosylation status by gel shift or glycosidase sensitivity

    • Glycosylated sites must be luminally oriented

TechniqueAdvantagesLimitationsData Output
Cysteine scanningSingle residue resolutionLabor intensiveAccessibility profile
Proteolytic mappingNo mutagenesis requiredLower resolutionProtected fragments
Fluorescence quenchingDynamic measurements possibleRequires purified proteinEnvironmental accessibility
Glycosylation mappingWorks in native cell systemsLimited to luminally accessible sitesBinary (glycosylated/not) data

Integrating data from multiple approaches provides the most reliable topological model.

How can researchers address solubility issues when working with NWMN_0840?

As a membrane protein, NWMN_0840 presents inherent solubility challenges. To address these issues, implement the following methodological strategies:

  • Optimization of expression conditions:

    • Lower induction temperature (16-18°C)

    • Reduce inducer concentration

    • Use specialized E. coli strains like C41(DE3) or C43(DE3) designed for membrane protein expression

    • Consider co-expression with chaperones

  • Detergent screening:

    • Systematically test multiple detergent classes:

      • Maltosides (DDM, UDM)

      • Glucosides (OG, NG)

      • Fos-cholines (FC-12, FC-14)

      • Neopentyl glycols (LMNG)

    • Evaluate protein stability using thermal shift assays

  • Alternative solubilization approaches:

    • Styrene maleic acid lipid particles (SMALPs)

    • Amphipols

    • Nanodiscs with various lipid compositions

    • Fluorinated surfactants

  • Buffer optimization:

    • Screen pH range (typically 6.5-8.5)

    • Test various salt concentrations (100-500 mM)

    • Include stabilizing additives (glycerol, trehalose, arginine)

    • Add specific lipids that may stabilize the protein

  • Construct engineering:

    • Try various tag positions (N-terminal vs. C-terminal)

    • Remove flexible regions predicted by disorder prediction algorithms

    • Consider fusion partners that enhance solubility (SUMO, MBP, TrxA)

Document each condition systematically in a multi-variable screening approach to identify optimal solubilization conditions .

What are the strategies for troubleshooting poor yield in NWMN_0840 expression?

When encountering poor yield during NWMN_0840 expression, implement this systematic troubleshooting approach:

  • Expression vector optimization:

    • Evaluate codon optimization for E. coli

    • Test different promoter strengths (T7, tac, ara)

    • Optimize ribosome binding site efficiency

    • Consider bicistronic design with translation enhancers

  • Host strain selection:

    • Compare BL21(DE3) variants with different protease deficiencies

    • Test Rosetta strains for rare codon supplementation

    • Evaluate specialized membrane protein expression strains

    • Consider expression in native S. aureus system

  • Growth and induction parameters:

    • Media composition (complex vs. defined, supplementation)

    • Cell density at induction (OD600 0.4-1.0)

    • Inducer concentration titration

    • Post-induction temperature and duration

    • Aeration conditions

  • Cell lysis optimization:

    • Comparison of mechanical methods (sonication, homogenization)

    • Enzymatic lysis approaches

    • Detergent concentration optimization

    • Buffer composition (pH, salt, additives)

  • Protein degradation prevention:

    • Include protease inhibitor cocktails

    • Work at reduced temperatures

    • Test strain with additional protease knockouts

    • Monitor stability over time with Western blots

For each modification, perform small-scale expression tests with quantitative yield assessment before scaling up to larger cultures.

How can NWMN_0840 be utilized in structural biology studies?

Structural characterization of NWMN_0840 requires specialized approaches due to its membrane protein nature. The following methodological strategies are recommended:

  • X-ray crystallography:

    • Vapor diffusion with detergent-solubilized protein

    • Lipidic cubic phase (LCP) crystallization

    • Addition of antibody fragments or nanobodies to increase polar surface area

    • Crystal screening with various detergents and lipid additives

  • Cryo-electron microscopy:

    • Single particle analysis for high-resolution structure

    • 2D crystallization in lipid bilayers

    • Reconstitution in nanodiscs or amphipols

    • Use of Volta phase plates for improved contrast

  • NMR spectroscopy:

    • Solution NMR for detergent-solubilized protein

    • Solid-state NMR for membrane-embedded forms

    • Selective isotope labeling to reduce spectral complexity

    • Chemical shift analysis for secondary structure determination

  • Computational approaches:

    • Ab initio modeling with membrane-specific force fields

    • AlphaFold2 prediction with membrane environment considerations

    • Molecular dynamics simulations to study flexibility and lipid interactions

    • Refinement of experimental structures in simulated membrane

Each method provides complementary information, and an integrated structural biology approach yields the most complete understanding of NWMN_0840 structure and function relationship.

What are the considerations for designing site-directed mutagenesis studies of NWMN_0840?

For rational design of site-directed mutagenesis studies to probe NWMN_0840 function and structure, consider the following methodological approach:

  • Target residue selection based on:

    • Sequence conservation analysis across homologs

    • Predicted functional motifs and domains

    • Transmembrane segment boundaries

    • Predicted substrate binding or catalytic sites

    • Charged residues within transmembrane regions

  • Mutation design strategy:

    • Conservative mutations (maintaining physicochemical properties)

    • Non-conservative mutations (altering charge, size, hydrophobicity)

    • Alanine scanning of functional regions

    • Cysteine substitutions for accessibility studies

    • Introduction of reporter amino acids (e.g., tryptophan)

  • Functional assay development:

    • Growth complementation assays

    • Substrate binding or transport assays

    • Protein-protein interaction assays

    • Membrane localization assessment

    • Stability and folding analysis

  • Data analysis and interpretation:

    • Categorize mutations by effect (null, hypomorphic, neutral, gain-of-function)

    • Map effects onto structural models

    • Compare with evolutionary conservation patterns

    • Develop mechanistic hypotheses based on mutation patterns

Mutation TypeExamplePurposeAnalysis Method
ConservativeLeu→Ile, Asp→GluProbe subtle structural requirementsActivity assays, thermal stability
Non-conservativeAsp→Ala, Lys→GluIdentify essential functional groupsActivity assays, binding studies
Cysteine substitutionXaa→CysAccessibility mapping, crosslinkingThiol labeling, disulfide scanning
Reporter insertionXaa→TrpMonitor local environment changesFluorescence spectroscopy
TruncationΔC-term, ΔN-termDomain function mappingActivity and localization assays

This comprehensive mutagenesis approach systematically dissects structure-function relationships in NWMN_0840.

How does NWMN_0840 compare with other UPF0344 family proteins?

The UPF0344 protein family, to which NWMN_0840 belongs, represents a group of uncharacterized proteins with conserved sequence features across bacterial species. A comparative analysis reveals:

  • Sequence conservation patterns:

    • Highly conserved transmembrane domains with distinctive sequence signatures

    • Variable N-terminal signal sequences

    • Conserved charged residues at predicted membrane interfaces

    • Distinctive GxxxG motifs suggesting helix-helix interactions within the membrane

  • Phylogenetic distribution:

    • Present primarily in Gram-positive bacteria

    • Highest conservation among Staphylococcal species

    • More distant homologs in other Firmicutes

    • Often found in similar genomic contexts across species

  • Structural predictions:

    • Consistent prediction of 4-5 transmembrane helices

    • Conserved loop regions of variable length

    • Potential ligand-binding pocket formed by transmembrane helices

  • Functional associations:

    • Co-occurrence with cell wall biosynthesis genes

    • Potential involvement in membrane organization or stress response

    • Expression patterns suggesting regulation during cell envelope stress

This comparative analysis provides context for functional hypotheses and experimental design when working with NWMN_0840.

What experimental approaches can differentiate NWMN_0840 function from other membrane proteins in S. aureus?

To specifically determine NWMN_0840 function distinct from other S. aureus membrane proteins, implement these differential experimental approaches:

  • Genetic interaction mapping:

    • Synthetic genetic array analysis with other membrane protein knockouts

    • Suppressor screening to identify functional relationships

    • Conditional essentiality testing under various stresses

    • Interaction with known membrane protein systems (secretion, transport)

  • Specific activity assays:

    • Membrane potential measurements in reconstituted systems

    • Ion flux assays with purified protein in liposomes

    • Substrate transport studies with radiolabeled compounds

    • Binding assays with potential ligands identified through computational screening

  • Structural and localization studies:

    • Super-resolution microscopy to map precise membrane localization

    • Co-localization with functional membrane domains (lipid rafts, division sites)

    • Temporal dynamics during cell cycle and stress responses

    • Interaction partners unique to NWMN_0840 vs. other membrane proteins

  • Comparative phenomics:

    • High-throughput phenotype screening of knockout strains

    • Chemical genetic profiling with antimicrobial compounds

    • Comparative transcriptomics and proteomics across multiple membrane protein mutants

    • Cross-species complementation studies

These approaches collectively provide a multi-dimensional profile of NWMN_0840 function that distinguishes it from other membrane proteins in the S. aureus proteome.

What are the current knowledge gaps regarding NWMN_0840 function?

Despite available structural and sequence information, significant knowledge gaps remain regarding NWMN_0840 function:

  • Physiological role:

    • No confirmed biological function in S. aureus physiology

    • Unknown regulatory mechanisms controlling expression

    • Uncertain contribution to bacterial survival or virulence

    • Undefined substrates or binding partners

  • Structural details:

    • Lack of high-resolution three-dimensional structure

    • Unknown oligomerization state in the membrane

    • Undefined conformational changes during function

    • Incomplete understanding of lipid interactions

  • Evolutionary context:

    • Limited understanding of selection pressures maintaining the gene

    • Unknown functional divergence among homologs

    • Undefined relationship to horizontally transferred elements

    • Unclear taxonomic distribution patterns

  • Therapeutic relevance:

    • Unknown potential as an antimicrobial target

    • Uncertain immunological relevance during infection

    • Undefined role in antibiotic resistance mechanisms

    • Unclear relationship to pathogenicity

These knowledge gaps represent opportunities for focused research efforts that could significantly advance understanding of bacterial membrane biology .

What novel methodologies might advance research on NWMN_0840 in the coming years?

Emerging technologies and methodological advances offer new opportunities to characterize NWMN_0840 function and structure:

  • Advanced structural biology approaches:

    • Cryo-electron tomography for in situ structural analysis

    • Integrative structural biology combining multiple data sources

    • Serial crystallography at X-ray free-electron lasers

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

  • High-throughput functional genomics:

    • CRISPR interference for conditional knockdowns

    • Transposon sequencing (Tn-seq) under diverse conditions

    • Genome-wide interaction mapping (genetic and physical)

    • Massively parallel reporter assays for regulatory analysis

  • Single-cell technologies:

    • Single-cell transcriptomics during infection

    • Microfluidic approaches for phenotypic heterogeneity

    • Single-molecule tracking in live cells

    • Correlative light and electron microscopy

  • Computational advances:

    • AI-driven structure prediction with AlphaFold2

    • Molecular dynamics simulations at extended timescales

    • Systems biology modeling of membrane protein networks

    • Virtual screening for small molecule modulators

  • Synthetic biology approaches:

    • Reconstitution in synthetic cells or vesicles

    • Directed evolution for function identification

    • Biosensor development based on NWMN_0840

    • Orthogonal translation for non-canonical amino acid incorporation

These innovative approaches, particularly when used in combination, have the potential to resolve the current knowledge gaps and advance understanding of NWMN_0840 function in bacterial physiology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.