The protein sequence includes motifs such as MLHLHILSWVLAIILFIATYLNISKNQGRSPFFKPLHMILRLFMLLTLISGFWILIQSFMNGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHTMFWITIALIIITMVLGVILPLGPISKLFGIG, as derived from UniProt annotations .
Pathway Involvement: While annotated in pathways (e.g., bacterial stress responses, virulence regulation), specific roles remain uncharacterized .
NWMN_0840 belongs to the UPF0344 family, a group of uncharacterized bacterial proteins. Limited functional data exist, but its expression in S. aureus suggests potential involvement in:
Pathogen-host interactions (e.g., immune evasion, adhesion).
Metabolic or regulatory pathways pending experimental validation .
Low Functional Characterization: Unlike well-studied S. aureus proteins (e.g., α-toxin, SpA), NWMN_0840 lacks documented immune modulation or enzymatic activity .
Limited Clinical Data: No direct studies link NWMN_0840 to S. aureus pathogenesis or human immunity .
Functional Role: Does NWMN_0840 contribute to S. aureus virulence or survival in host environments?
Immunogenicity: Can it elicit protective immune responses akin to CgoX or TPI in vaccine models ?
Structural Insights: Does its 3D structure reveal functional motifs (e.g., enzymatic domains)?
Knockout Studies: Generate ΔNWMN_0840 mutants to assess virulence in murine models.
Epitope Mapping: Identify immunogenic regions for vaccine design.
Proteomic Interactions: Screen for host or bacterial binding partners.
KEGG: sae:NWMN_0840
Based on sequence analysis, NWMN_0840 belongs to the UPF0344 protein family and contains multiple transmembrane helices. The protein has a characteristic hydrophobicity pattern with alternating hydrophobic and hydrophilic regions. The N-terminal region (residues 1-20) contains a conserved signal sequence typical of membrane-integrated proteins, while the C-terminal region (approximately residues 100-129) appears to have a more hydrophilic character, potentially functioning in protein-protein interactions or substrate binding. This structural arrangement is consistent with its predicted localization to the bacterial cell membrane .
The commercially available Recombinant Staphylococcus aureus UPF0344 protein NWMN_0840 is expressed in E. coli expression systems. For optimal expression, using BL21(DE3) E. coli strains with pET-based vectors is recommended, as these systems provide tight control of protein expression through IPTG induction. When designing your expression protocol, consider the following parameters:
Induction temperature: 16-18°C for overnight expression to reduce inclusion body formation
IPTG concentration: 0.1-0.5 mM (optimize for your specific construct)
Media: Terrific Broth (TB) or 2xYT for higher yield
OD600 at induction: 0.6-0.8 for optimal balance between cell density and expression efficiency
As a membrane protein, NWMN_0840 may present solubility challenges, so expression conditions may need optimization to balance yield and proper folding .
Since NWMN_0840 is typically produced with an N-terminal His tag, immobilized metal affinity chromatography (IMAC) is the recommended first purification step. A methodological approach should include:
Cell lysis using either sonication or high-pressure homogenization in a buffer containing:
50 mM Tris-HCl, pH 8.0
300 mM NaCl
10 mM imidazole
1% appropriate detergent (e.g., n-Dodecyl β-D-maltoside)
Protease inhibitors
IMAC purification using Ni-NTA or Co-based resins with:
Binding: 20 mM imidazole
Washing: 40-60 mM imidazole
Elution: 250-300 mM imidazole gradient
Size-exclusion chromatography as a polishing step in a buffer containing:
20 mM Tris-HCl, pH 7.5
150 mM NaCl
0.03-0.05% detergent
The final purity should exceed 90% as determined by SDS-PAGE analysis .
The recombinant NWMN_0840 protein requires specific storage conditions to maintain stability and activity. For long-term storage, the protein should be stored at -20°C to -80°C, with -80°C being preferable for extended periods. The protein is typically supplied as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. After reconstitution, it is recommended to add glycerol to a final concentration of 50% to prevent freeze-thaw damage. Working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and loss of activity .
For optimal reconstitution of lyophilized NWMN_0840 protein, follow this methodological approach:
Briefly centrifuge the vial containing lyophilized protein to ensure all material is at the bottom
Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL
Gently mix by swirling or slow pipetting to avoid protein denaturation (do not vortex)
Add glycerol to a final concentration of 50% for cryoprotection
Aliquot the reconstituted protein into smaller volumes based on experimental needs
Flash-freeze aliquots in liquid nitrogen before transferring to -80°C storage
The reconstitution buffer should be Tris/PBS-based with pH 8.0 and may include 6% trehalose as a stabilizing agent. For membrane protein studies, consider adding a mild detergent at concentrations just above its critical micelle concentration (CMC) to maintain protein solubility without causing denaturation .
When designing experiments involving NWMN_0840 protein, proper controls are essential for result validation. A comprehensive experimental design should include:
Negative controls:
Buffer-only conditions (no protein)
Heat-denatured NWMN_0840 protein
Unrelated protein with similar size/tag system
Positive controls:
Known functional membrane protein from S. aureus
Previously validated batch of NWMN_0840 (if available)
Tag controls:
His-tagged control protein to account for tag interference
If possible, both tagged and untagged versions of NWMN_0840
Concentration gradient:
Multiple concentrations of NWMN_0840 to establish dose-response relationships
These controls allow for robust statistical analysis and help distinguish specific protein effects from experimental artifacts. For membrane protein studies, especially consider controls that account for detergent effects or reconstitution variability .
To investigate the membrane localization and topology of NWMN_0840, a multi-faceted experimental approach is recommended:
Subcellular fractionation:
Separate cytoplasmic, periplasmic, and membrane fractions
Analyze by Western blot with anti-His antibodies
Include known marker proteins for each fraction as controls
Fluorescence microscopy:
Create GFP/mCherry fusion constructs with NWMN_0840
Express in appropriate bacterial systems
Co-localize with membrane-specific dyes
Protease accessibility assays:
Create inside-out and right-side-out membrane vesicles
Treat with proteases and analyze protected fragments
Map the orientation of domains relative to the membrane
Cryo-electron microscopy:
For high-resolution structural information in membrane context
Use reconstituted protein in nanodiscs or liposomes
This comprehensive approach provides complementary data that collectively reveals the true membrane topology of NWMN_0840 protein .
For detailed characterization of NWMN_0840 secondary structure, multiple complementary spectroscopic techniques should be employed:
Circular Dichroism (CD) Spectroscopy:
Far-UV CD (190-250 nm) to quantify α-helical, β-sheet, and random coil content
Near-UV CD (250-350 nm) to probe tertiary structure
Thermal melting experiments to assess stability
Buffer considerations: low chloride concentration, detergents without chiral centers
Fourier Transform Infrared Spectroscopy (FTIR):
Particularly valuable for membrane proteins
Amide I region (1600-1700 cm⁻¹) analysis for secondary structure composition
Can be performed in various membrane mimetics
Nuclear Magnetic Resonance (NMR):
HSQC experiments to analyze protein fold integrity
TOCSY and NOESY for detailed structural information
Requires ¹⁵N/¹³C labeled protein for detailed analysis
A combined approach using these techniques provides a comprehensive view of NWMN_0840 structure in different environments and can reveal conformational changes upon substrate binding or environmental perturbations.
To systematically characterize protein-protein interactions involving NWMN_0840, employ these methodological approaches:
Pull-down assays and co-immunoprecipitation:
Utilize the His-tag for affinity capture
Cross-linking prior to lysis can capture transient interactions
Mass spectrometry identification of binding partners
Surface Plasmon Resonance (SPR):
Immobilize NWMN_0840 on sensor chip via His-tag
Flow potential partners over the surface
Determine binding kinetics (kon, koff) and affinity (KD)
Microscale Thermophoresis (MST):
Fluorescently label NWMN_0840
Titrate unlabeled potential binding partners
Analyze thermophoretic mobility changes
Bacterial Two-Hybrid System:
Create fusion constructs with split reporter domains
Co-express in bacterial system
Screen for interaction-dependent reporter activation
Blue Native PAGE:
Particularly useful for membrane protein complexes
Preserves native protein interactions during separation
Western blot analysis to identify complex components
For each method, proper controls must be included to distinguish specific from non-specific interactions. The complementary nature of these techniques provides validation across different experimental conditions.
Determining the physiological function of NWMN_0840, which currently has an uncharacterized function (UPF designation), requires a systematic multi-faceted approach:
Genetic approaches:
Generate knockout/knockdown strains in S. aureus
Perform phenotypic characterization under various growth conditions
Complementation studies with wild-type and mutant versions
Fitness assessment in competitive growth assays
Transcriptomic analysis:
RNA-seq comparison between wild-type and NWMN_0840 mutant strains
Identify differentially expressed genes and pathways
Condition-dependent expression profiling
Protein localization and trafficking:
Fluorescent protein fusions to track subcellular localization
Co-localization with known membrane components
Membrane fractionation and proteomic analysis
Computational predictions:
Homology modeling based on structurally characterized proteins
Molecular dynamics simulations in membrane environment
Virtual screening for potential substrates or binding partners
Metabolomic profiling:
Compare metabolite profiles between wild-type and mutant strains
Isotope labeling to track potential substrate transformations
Targeted assays based on computational predictions
This integrated approach maximizes the likelihood of identifying the true physiological function of this uncharacterized protein.
To experimentally determine the membrane integration and topology of NWMN_0840, employ the following methodological approaches:
Cysteine scanning mutagenesis:
Create a cysteine-free version of NWMN_0840
Introduce single cysteines at strategic positions
Label with membrane-impermeable thiol-reactive probes
Accessibility pattern reveals membrane-spanning regions
Proteolytic mapping:
Create membrane vesicles with defined orientation
Limited proteolysis with proteases like trypsin or chymotrypsin
Mass spectrometry analysis of protected fragments
Compare results between right-side-out and inside-out vesicles
Fluorescence quenching:
Introduce fluorescent labels at specific positions
Measure accessibility to water-soluble and membrane-embedded quenchers
Reconstruct topology from quenching patterns
Glycosylation mapping:
Introduce glycosylation sites at strategic positions
Express in a glycosylation-competent system
Assess glycosylation status by gel shift or glycosidase sensitivity
Glycosylated sites must be luminally oriented
| Technique | Advantages | Limitations | Data Output |
|---|---|---|---|
| Cysteine scanning | Single residue resolution | Labor intensive | Accessibility profile |
| Proteolytic mapping | No mutagenesis required | Lower resolution | Protected fragments |
| Fluorescence quenching | Dynamic measurements possible | Requires purified protein | Environmental accessibility |
| Glycosylation mapping | Works in native cell systems | Limited to luminally accessible sites | Binary (glycosylated/not) data |
Integrating data from multiple approaches provides the most reliable topological model.
As a membrane protein, NWMN_0840 presents inherent solubility challenges. To address these issues, implement the following methodological strategies:
Optimization of expression conditions:
Lower induction temperature (16-18°C)
Reduce inducer concentration
Use specialized E. coli strains like C41(DE3) or C43(DE3) designed for membrane protein expression
Consider co-expression with chaperones
Detergent screening:
Systematically test multiple detergent classes:
Maltosides (DDM, UDM)
Glucosides (OG, NG)
Fos-cholines (FC-12, FC-14)
Neopentyl glycols (LMNG)
Evaluate protein stability using thermal shift assays
Alternative solubilization approaches:
Styrene maleic acid lipid particles (SMALPs)
Amphipols
Nanodiscs with various lipid compositions
Fluorinated surfactants
Buffer optimization:
Screen pH range (typically 6.5-8.5)
Test various salt concentrations (100-500 mM)
Include stabilizing additives (glycerol, trehalose, arginine)
Add specific lipids that may stabilize the protein
Construct engineering:
Try various tag positions (N-terminal vs. C-terminal)
Remove flexible regions predicted by disorder prediction algorithms
Consider fusion partners that enhance solubility (SUMO, MBP, TrxA)
Document each condition systematically in a multi-variable screening approach to identify optimal solubilization conditions .
When encountering poor yield during NWMN_0840 expression, implement this systematic troubleshooting approach:
Expression vector optimization:
Evaluate codon optimization for E. coli
Test different promoter strengths (T7, tac, ara)
Optimize ribosome binding site efficiency
Consider bicistronic design with translation enhancers
Host strain selection:
Compare BL21(DE3) variants with different protease deficiencies
Test Rosetta strains for rare codon supplementation
Evaluate specialized membrane protein expression strains
Consider expression in native S. aureus system
Growth and induction parameters:
Media composition (complex vs. defined, supplementation)
Cell density at induction (OD600 0.4-1.0)
Inducer concentration titration
Post-induction temperature and duration
Aeration conditions
Cell lysis optimization:
Comparison of mechanical methods (sonication, homogenization)
Enzymatic lysis approaches
Detergent concentration optimization
Buffer composition (pH, salt, additives)
Protein degradation prevention:
Include protease inhibitor cocktails
Work at reduced temperatures
Test strain with additional protease knockouts
Monitor stability over time with Western blots
For each modification, perform small-scale expression tests with quantitative yield assessment before scaling up to larger cultures.
Structural characterization of NWMN_0840 requires specialized approaches due to its membrane protein nature. The following methodological strategies are recommended:
X-ray crystallography:
Vapor diffusion with detergent-solubilized protein
Lipidic cubic phase (LCP) crystallization
Addition of antibody fragments or nanobodies to increase polar surface area
Crystal screening with various detergents and lipid additives
Cryo-electron microscopy:
Single particle analysis for high-resolution structure
2D crystallization in lipid bilayers
Reconstitution in nanodiscs or amphipols
Use of Volta phase plates for improved contrast
NMR spectroscopy:
Solution NMR for detergent-solubilized protein
Solid-state NMR for membrane-embedded forms
Selective isotope labeling to reduce spectral complexity
Chemical shift analysis for secondary structure determination
Computational approaches:
Ab initio modeling with membrane-specific force fields
AlphaFold2 prediction with membrane environment considerations
Molecular dynamics simulations to study flexibility and lipid interactions
Refinement of experimental structures in simulated membrane
Each method provides complementary information, and an integrated structural biology approach yields the most complete understanding of NWMN_0840 structure and function relationship.
For rational design of site-directed mutagenesis studies to probe NWMN_0840 function and structure, consider the following methodological approach:
Target residue selection based on:
Sequence conservation analysis across homologs
Predicted functional motifs and domains
Transmembrane segment boundaries
Predicted substrate binding or catalytic sites
Charged residues within transmembrane regions
Mutation design strategy:
Conservative mutations (maintaining physicochemical properties)
Non-conservative mutations (altering charge, size, hydrophobicity)
Alanine scanning of functional regions
Cysteine substitutions for accessibility studies
Introduction of reporter amino acids (e.g., tryptophan)
Functional assay development:
Growth complementation assays
Substrate binding or transport assays
Protein-protein interaction assays
Membrane localization assessment
Stability and folding analysis
Data analysis and interpretation:
Categorize mutations by effect (null, hypomorphic, neutral, gain-of-function)
Map effects onto structural models
Compare with evolutionary conservation patterns
Develop mechanistic hypotheses based on mutation patterns
| Mutation Type | Example | Purpose | Analysis Method |
|---|---|---|---|
| Conservative | Leu→Ile, Asp→Glu | Probe subtle structural requirements | Activity assays, thermal stability |
| Non-conservative | Asp→Ala, Lys→Glu | Identify essential functional groups | Activity assays, binding studies |
| Cysteine substitution | Xaa→Cys | Accessibility mapping, crosslinking | Thiol labeling, disulfide scanning |
| Reporter insertion | Xaa→Trp | Monitor local environment changes | Fluorescence spectroscopy |
| Truncation | ΔC-term, ΔN-term | Domain function mapping | Activity and localization assays |
This comprehensive mutagenesis approach systematically dissects structure-function relationships in NWMN_0840.
The UPF0344 protein family, to which NWMN_0840 belongs, represents a group of uncharacterized proteins with conserved sequence features across bacterial species. A comparative analysis reveals:
Sequence conservation patterns:
Highly conserved transmembrane domains with distinctive sequence signatures
Variable N-terminal signal sequences
Conserved charged residues at predicted membrane interfaces
Distinctive GxxxG motifs suggesting helix-helix interactions within the membrane
Phylogenetic distribution:
Present primarily in Gram-positive bacteria
Highest conservation among Staphylococcal species
More distant homologs in other Firmicutes
Often found in similar genomic contexts across species
Structural predictions:
Consistent prediction of 4-5 transmembrane helices
Conserved loop regions of variable length
Potential ligand-binding pocket formed by transmembrane helices
Functional associations:
Co-occurrence with cell wall biosynthesis genes
Potential involvement in membrane organization or stress response
Expression patterns suggesting regulation during cell envelope stress
This comparative analysis provides context for functional hypotheses and experimental design when working with NWMN_0840.
To specifically determine NWMN_0840 function distinct from other S. aureus membrane proteins, implement these differential experimental approaches:
Genetic interaction mapping:
Synthetic genetic array analysis with other membrane protein knockouts
Suppressor screening to identify functional relationships
Conditional essentiality testing under various stresses
Interaction with known membrane protein systems (secretion, transport)
Specific activity assays:
Membrane potential measurements in reconstituted systems
Ion flux assays with purified protein in liposomes
Substrate transport studies with radiolabeled compounds
Binding assays with potential ligands identified through computational screening
Structural and localization studies:
Super-resolution microscopy to map precise membrane localization
Co-localization with functional membrane domains (lipid rafts, division sites)
Temporal dynamics during cell cycle and stress responses
Interaction partners unique to NWMN_0840 vs. other membrane proteins
Comparative phenomics:
High-throughput phenotype screening of knockout strains
Chemical genetic profiling with antimicrobial compounds
Comparative transcriptomics and proteomics across multiple membrane protein mutants
Cross-species complementation studies
These approaches collectively provide a multi-dimensional profile of NWMN_0840 function that distinguishes it from other membrane proteins in the S. aureus proteome.
Despite available structural and sequence information, significant knowledge gaps remain regarding NWMN_0840 function:
Physiological role:
No confirmed biological function in S. aureus physiology
Unknown regulatory mechanisms controlling expression
Uncertain contribution to bacterial survival or virulence
Undefined substrates or binding partners
Structural details:
Lack of high-resolution three-dimensional structure
Unknown oligomerization state in the membrane
Undefined conformational changes during function
Incomplete understanding of lipid interactions
Evolutionary context:
Limited understanding of selection pressures maintaining the gene
Unknown functional divergence among homologs
Undefined relationship to horizontally transferred elements
Unclear taxonomic distribution patterns
Therapeutic relevance:
Unknown potential as an antimicrobial target
Uncertain immunological relevance during infection
Undefined role in antibiotic resistance mechanisms
Unclear relationship to pathogenicity
These knowledge gaps represent opportunities for focused research efforts that could significantly advance understanding of bacterial membrane biology .
Emerging technologies and methodological advances offer new opportunities to characterize NWMN_0840 function and structure:
Advanced structural biology approaches:
Cryo-electron tomography for in situ structural analysis
Integrative structural biology combining multiple data sources
Serial crystallography at X-ray free-electron lasers
Hydrogen-deuterium exchange mass spectrometry for dynamics
High-throughput functional genomics:
CRISPR interference for conditional knockdowns
Transposon sequencing (Tn-seq) under diverse conditions
Genome-wide interaction mapping (genetic and physical)
Massively parallel reporter assays for regulatory analysis
Single-cell technologies:
Single-cell transcriptomics during infection
Microfluidic approaches for phenotypic heterogeneity
Single-molecule tracking in live cells
Correlative light and electron microscopy
Computational advances:
AI-driven structure prediction with AlphaFold2
Molecular dynamics simulations at extended timescales
Systems biology modeling of membrane protein networks
Virtual screening for small molecule modulators
Synthetic biology approaches:
Reconstitution in synthetic cells or vesicles
Directed evolution for function identification
Biosensor development based on NWMN_0840
Orthogonal translation for non-canonical amino acid incorporation
These innovative approaches, particularly when used in combination, have the potential to resolve the current knowledge gaps and advance understanding of NWMN_0840 function in bacterial physiology and pathogenesis.