Recombinant Staphylococcus aureus UPF0344 protein SACOL0974 (SACOL0974)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics and Production

SACOL0974 is a transmembrane protein with a predicted molecular weight of 14,539 Da and spans 129 amino acids (AA 1–129) . Key properties include:

PropertySpecification
Expression SystemCell-free systems or E. coli (varies by manufacturer)
Purity≥85% as determined by SDS-PAGE (lot-specific)
Host StrainS. aureus subsp. aureus strain COL
SequenceMLHLHILSWVL...PISKLFGIG (full sequence: )
Storage-20°C or -80°C (repeated freezing/thawing not recommended)

Recombinant production avoids reliance on native S. aureus cultures, reducing biosafety risks while enabling controlled purification .

Classification

  • UPF0344 Family: Uncharacterized Protein Family 0344 (UPF0344), a group of hypothetical proteins with no known catalytic domains or conserved motifs .

  • Transmembrane Topology: Predicted to contain membrane-spanning helices, suggesting potential roles in transport or signaling .

Experimental Uses

SACOL0974 is primarily marketed as a research tool for:

  1. Protein Interaction Studies: Investigating binding partners in S. aureus pathogenesis or host-microbe interactions.

  2. Antigen Development: Potential inclusion in multi-antigen vaccine formulations (e.g., alongside virulence factors like SpA or Hla) .

  3. Structural Biology: Crystallization or NMR studies to resolve transmembrane domain architecture .

Limitations

  • Functional Data Gap: No peer-reviewed studies directly linking SACOL0974 to bacterial pathogenesis, stress responses, or host immune evasion.

  • Expression Challenges: Cell-free production may yield non-natively folded protein, requiring refolding optimization .

Unanswered Questions and Future Directions

  1. Functional Annotation: CRISPR knockout or RNAi depletion studies to elucidate role in S. aureus survival or infection.

  2. Interactome Mapping: Co-IP or yeast two-hybrid assays to identify binding partners (e.g., membrane proteins, chaperones).

  3. Vaccine Potential: Testing as a candidate antigen in conjugate vaccines alongside capsular polysaccharides or toxins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing the order and we will fulfill it to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50% and can be used as a reference point.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us and we will prioritize development of your specified tag.
Synonyms
SACOL0974; UPF0344 protein SACOL0974
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Staphylococcus aureus (strain COL)
Target Names
SACOL0974
Target Protein Sequence
MLHLHILSWVLAIILFIATYLNISKNQGRSPFFKPLHMILRLFMLLTLISGFWILIQSFM NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHTMFWITIALIIITMVLGVILPLG PISKLFGIG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0344 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of UPF0344 protein SACOL0974?

UPF0344 protein SACOL0974 is a protein encoded by the SACOL0974 gene in Staphylococcus aureus strain COL. The full amino acid sequence is: mLHLHILSWVLAIILFIATYLNISKNQGRSPFFKPLHMILRLFmLLTLISGFWILIQSFMNGGANHmLLTLKmLCGVAVVGLMEVSIAKRKRHEQSHTMFWITIALIIITMVLGVILPLGPISKLFGIG . It has an expression region spanning residues 1-129, with the UniProt accession number Q5HHB5 . The protein appears to contain multiple transmembrane regions, as suggested by its hydrophobic amino acid composition.

What are the optimal storage conditions for Recombinant SACOL0974 protein?

For Recombinant SACOL0974 protein, optimal storage conditions include:

Storage PurposeTemperatureAdditional Conditions
Short-term storage4°CUp to one week as working aliquots
Standard storage-20°CIn Tris-based buffer with 50% glycerol
Long-term storage-80°CIn Tris-based buffer with 50% glycerol

Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and activity . When preparing working solutions, it is recommended to thaw the protein once and divide it into smaller aliquots for daily experimental use.

What experimental techniques are most appropriate for analyzing SACOL0974 function?

As a membrane-associated protein based on its sequence characteristics, SACOL0974 function can be analyzed using:

  • Protein Localization Studies: Immunofluorescence microscopy to determine subcellular localization

  • Protein-Protein Interaction Analysis: Co-immunoprecipitation, yeast two-hybrid, or bacterial two-hybrid systems

  • Expression Analysis: qRT-PCR and Western blotting to assess expression under different conditions

  • Structural Analysis: X-ray crystallography or NMR spectroscopy

  • Functional Assays: Gene knockout/knockdown studies followed by phenotypic analysis

For recombinant protein studies specifically, ELISA-based techniques can be valuable for quantifying protein levels and assessing antibody responses in immunological studies .

How should researchers design experiments to study the immunogenic properties of SACOL0974?

When designing experiments to study SACOL0974 immunogenicity:

  • Animal Model Selection: Mouse models are appropriate for initial immunogenicity studies, with consideration for both sepsis and pneumonia models as demonstrated with other S. aureus antigens

  • Vaccination Protocol Design:

    • Control groups should include adjuvant-only and non-vaccinated groups

    • Multiple dosing schedules should be tested (typically prime + 1-2 boosts)

    • Route of administration (subcutaneous, intramuscular, intranasal) should be compared

  • Immune Response Assessment:

    • Humoral immunity: Measure antigen-specific antibodies (IgG, IgA) by ELISA

    • Cellular immunity: Flow cytometry for T-cell responses (CD4+, CD8+)

    • Functional antibody testing using opsonophagocytic killing assays

  • Challenge Studies Design:

    • Use clinically relevant S. aureus strains

    • Monitor bacterial loads in organs, inflammatory markers, and survival rates

    • Include time-course analysis to determine immune kinetics

This approach aligns with successful methodologies used for other S. aureus antigen research, such as the recombinant five-antigen S. aureus vaccine study .

What statistical approaches are most appropriate for analyzing SACOL0974 experimental data?

The selection of statistical methods should be guided by your specific research objectives and experimental design:

Research ObjectiveDesign TypeRecommended Statistical Approach
Compare protein expression levels across conditionsExperimentalANOVA with post-hoc tests (Tukey or Bonferroni)
Assess correlation between SACOL0974 levels and virulenceCorrelationalPearson or Spearman correlation coefficients
Evaluate vaccine efficacy in protection studiesExperimentalKaplan-Meier survival analysis with log-rank test
Compare immunological responses between groupsExperimentalt-tests or non-parametric equivalents (Mann-Whitney)
Analyze time-course dataExperimentalRepeated measures ANOVA or mixed-effects models

When designing your analysis strategy:

  • Determine if your data meets the assumptions for parametric tests (normality, homogeneity of variance)

  • Calculate appropriate sample sizes using power analysis to ensure statistical validity

  • Control for multiple comparisons when necessary (e.g., Bonferroni correction)

  • Consider effect size calculations to determine the biological significance of your findings

How can researchers effectively isolate and purify SACOL0974 for functional studies?

For optimal isolation and purification of SACOL0974:

  • Expression System Selection:

    • Escherichia coli is the most common system for recombinant expression

    • BL21(DE3) strain typically offers good expression for S. aureus proteins

    • Consider codon optimization for improved expression levels

  • Expression Vector Design:

    • Include an appropriate fusion tag (His6, GST, MBP) for purification

    • For membrane proteins like SACOL0974, consider using fusion partners that enhance solubility

    • Include a precision protease cleavage site for tag removal

  • Purification Strategy:

    • For His-tagged constructs: Immobilized metal affinity chromatography (IMAC)

    • Secondary purification: Size exclusion chromatography

    • For membrane proteins: Consider detergent screening to identify optimal solubilization conditions

  • Quality Control Assessment:

    • SDS-PAGE and Western blotting to confirm purity and identity

    • Mass spectrometry for accurate molecular weight determination

    • Circular dichroism to assess secondary structure integrity

This methodological approach ensures that purified SACOL0974 maintains its native structure and function for downstream analyses .

What approaches can be used to investigate the potential role of SACOL0974 in S. aureus pathogenesis?

To investigate SACOL0974's role in pathogenesis:

  • Gene Knockout/Complementation Studies:

    • Generate ΔSACOL0974 mutant strains using allelic replacement

    • Create complemented strains to confirm phenotype specificity

    • Compare virulence between wild-type, mutant, and complemented strains in animal models

  • Transcriptomic/Proteomic Analysis:

    • Perform RNA-Seq to identify genes differentially regulated in ΔSACOL0974 mutants

    • Use proteomics to identify changes in protein expression profiles

    • Analyze results using pathway enrichment tools to identify affected biological processes

  • Host-Pathogen Interaction Studies:

    • Assess adherence to and invasion of relevant host cells

    • Measure cytokine production by infected host cells

    • Evaluate neutrophil recruitment and function in response to infection

  • Comparative Virulence Analysis:

    • Test virulence in multiple infection models (skin, pneumonia, bacteremia)

    • Compare results across different clinical isolates

    • Assess bacterial persistence and immune evasion mechanisms

This comprehensive approach allows for robust characterization of SACOL0974's role in S. aureus pathogenicity, similar to methodologies used for other virulence factors .

How does SACOL0974 compare structurally and functionally to other UPF0344 family proteins?

When comparing SACOL0974 to other UPF0344 family proteins:

  • Structural Comparison:

    • Perform multiple sequence alignment to identify conserved domains and motifs

    • Use homology modeling to predict structural similarities and differences

    • Compare predicted transmembrane topology patterns

  • Evolutionary Analysis:

    • Conduct phylogenetic analysis of UPF0344 proteins across bacterial species

    • Calculate selection pressures (dN/dS ratios) to identify evolutionarily conserved regions

    • Analyze synteny of genomic regions containing UPF0344 genes

  • Functional Comparison:

    • Compare phenotypes of knockout mutants across species

    • Assess protein-protein interaction networks

    • Evaluate expression patterns under diverse environmental conditions

  • Host Response Comparison:

    • Compare immunogenicity profiles

    • Assess cross-reactivity of antibodies against different UPF0344 proteins

    • Evaluate protective efficacy in vaccination studies

This comparative approach provides context for understanding SACOL0974's unique properties within its protein family and may reveal conserved functions across bacterial species.

How can SACOL0974 be incorporated into multi-antigen vaccine formulations against S. aureus?

To incorporate SACOL0974 into multi-antigen vaccine formulations:

  • Antigen Combination Strategy:

    • Evaluate compatibility with established S. aureus vaccine antigens (Hla, SEB, SpA, IsdB-N2, MntC)

    • Determine optimal protein ratios through titration experiments

    • Assess potential for antigenic competition through immunological studies

  • Formulation Optimization:

    • Test multiple adjuvant systems (aluminum salts, oil-in-water emulsions, TLR agonists)

    • Evaluate different delivery platforms (soluble protein, nanoparticles, virus-like particles)

    • Assess stability of SACOL0974 in combination with other antigens

  • Immunogenicity Testing:

    • Compare immune responses to SACOL0974 alone versus in combination

    • Analyze epitope spreading and antibody affinity maturation

    • Evaluate T cell responses to confirm balanced Th1/Th2/Th17 activation

  • Protection Studies:

    • Determine if SACOL0974 inclusion enhances protection compared to established formulations

    • Test protection against diverse clinical isolates

    • Evaluate long-term immunity and need for booster doses

This approach follows established principles for rational multi-antigen vaccine design as demonstrated in the development of the recombinant five-antigen S. aureus vaccine .

What methodologies can assess the contribution of SACOL0974-specific antibodies to protective immunity?

To evaluate the contribution of SACOL0974-specific antibodies to protection:

  • Antibody Functionality Assays:

    • Opsonophagocytic killing assays to assess neutrophil-mediated bacterial clearance

    • Neutralization assays if SACOL0974 has toxin-like activity

    • Complement deposition assays to evaluate complement activation

  • Passive Immunization Studies:

    • Transfer purified anti-SACOL0974 antibodies to naïve animals

    • Challenge with S. aureus and assess protection

    • Compare with antibodies against other S. aureus antigens

  • Antibody Depletion Experiments:

    • Deplete specific antibody populations from immune serum

    • Assess impact on protective efficacy

    • Reconstitute with purified antibodies to confirm specificity

  • Correlation Analysis:

    • Correlate antibody titers, affinity, and function with protection status

    • Perform multi-parameter analysis to identify protective antibody features

    • Compare protective correlates across different infection models

These methodologies allow for rigorous assessment of antibody contributions to immunity, similar to approaches used for evaluating other S. aureus vaccine candidates .

How should researchers address variability in SACOL0974 expression across different S. aureus strains?

To address strain-to-strain variability in SACOL0974 expression:

  • Strain Selection Strategy:

    • Include representatives from major S. aureus lineages (CC5, CC8, CC30, etc.)

    • Incorporate both methicillin-sensitive (MSSA) and methicillin-resistant (MRSA) isolates

    • Include clinical isolates from different infection types (wound, bloodstream, etc.)

  • Expression Analysis Methodology:

    • Use standardized growth conditions for all strains

    • Employ absolute quantification methods (e.g., digital PCR for transcript levels)

    • Normalize protein expression to total protein or reliable housekeeping genes

  • Statistical Approaches for Variability Analysis:

    • Apply mixed-effects models to account for strain-specific random effects

    • Use clustering analyses to identify strain groupings based on expression patterns

    • Employ analysis of variance components to quantify sources of variability

  • Data Interpretation Framework:

    • Correlate expression levels with strain characteristics (virulence, antibiotic resistance)

    • Consider evolutionary analysis to understand selective pressures on expression

    • Evaluate impact of variability on vaccine design implications

This systematic approach enables robust characterization of expression patterns across the species, supporting rational design of broadly effective interventions .

What experimental controls are critical in studies evaluating SACOL0974 as a potential vaccine antigen?

When evaluating SACOL0974 as a vaccine antigen, implement these critical controls:

Control TypePurposeImplementation
Adjuvant-only controlDistinguish adjuvant effects from antigen-specific responsesInclude groups receiving only the adjuvant formulation
Irrelevant antigen controlControl for non-specific protein immunization effectsUse a non-S. aureus protein of similar size/structure
Positive control antigenBenchmark protective efficacyInclude a known protective S. aureus antigen (e.g., Hla)
Dose-response controlsDetermine optimal antigen dosingTest multiple concentrations of SACOL0974
Challenge strain controlsEnsure broad protectionChallenge with multiple S. aureus strains
Long-term immunity controlsAssess durability of protectionInclude time-course sampling and delayed challenge
Cross-reactivity controlsEvaluate specificity of immune responsesTest reactivity against related proteins

Additionally, technical controls should include:

  • Endotoxin testing of recombinant proteins

  • Protein purity verification

  • Confirmation of protein folding/conformation

  • Baseline immunity assessment in experimental animals

What emerging technologies could enhance SACOL0974 research?

Several cutting-edge technologies show promise for advancing SACOL0974 research:

  • CRISPR-Cas9 Applications:

    • Precise genome editing for functional genomics studies

    • CRISPRi approaches for conditional gene repression

    • CRISPR screening to identify genetic interactions

  • Advanced Structural Biology Techniques:

    • Cryo-electron microscopy for membrane protein structures

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Single-molecule FRET for protein dynamics studies

  • Systems Biology Approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Network analysis to position SACOL0974 in virulence pathways

    • Machine learning for predictive modeling of protein function

  • Advanced Immunological Methods:

    • Single-cell RNA-seq for detailed immune response profiling

    • Mass cytometry (CyTOF) for comprehensive immune cell phenotyping

    • Repertoire sequencing to characterize B and T cell responses

  • Novel Vaccine Delivery Platforms:

    • mRNA-based antigen delivery systems

    • Self-assembling nanoparticle platforms

    • Biofilm-targeting delivery strategies

Integrating these technologies can significantly accelerate understanding of SACOL0974 biology and its potential applications in S. aureus vaccine development.

What are the key challenges in translating SACOL0974 research from laboratory to clinical applications?

The translation of SACOL0974 research faces several significant challenges:

  • Scientific Challenges:

    • Demonstrating consistent expression across clinically relevant strains

    • Establishing clear correlates of protection

    • Addressing strain-to-strain antigenic variation

    • Understanding potential immunomodulatory effects

  • Preclinical Development Hurdles:

    • Selecting appropriate animal models that predict human responses

    • Scaling up GMP-compliant protein production

    • Formulation stability and compatibility with other antigens

    • Determining optimal dosing and administration routes

  • Clinical Development Considerations:

    • Designing appropriate clinical endpoints for S. aureus vaccines

    • Identifying suitable at-risk populations for clinical trials

    • Addressing potential immune enhancement concerns

    • Developing appropriate biomarkers for immunogenicity

  • Regulatory Perspectives:

    • Meeting safety requirements for novel antigens

    • Addressing previous S. aureus vaccine failures in regulatory submissions

    • Developing appropriate potency assays for lot release

Overcoming these challenges requires systematic research progression and collaboration between academic researchers, industry partners, and regulatory agencies to advance promising candidates toward clinical evaluation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.