Recombinant Staphylococcus aureus UPF0344 protein SAHV_0964 (SAHV_0964)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

SAHV_0964 is classified as a UPF0344 family protein, though its exact biological function remains uncharacterized in current literature. Key features include:

PropertyDetail
Uniprot IDA7X0I5
Gene LocusSAHV_0964 (Ordered locus name)
Expression RegionAmino acids 1–129 (full-length protein)
TagDetermined during production (commonly His-tag or GST)
Molecular Weight~15 kDa (calculated based on 129 amino acids)
SequencemLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFmLLTLISGFWILIQSFM NGGANHmLLTLKmLCGVAVVGLMEVSIAKRKRHEQSHKMFWITMALIIITMVLGVILPLG PISKLFGIG

The protein contains a conserved domain architecture typical of uncharacterized bacterial proteins, with potential transmembrane regions inferred from its hydrophobic amino acid distribution .

Production and Quality Control

Produced via recombinant expression systems (likely E. coli), SAHV_0964 undergoes rigorous purification:

  • Purity: >90% (SDS-PAGE verified)

  • Storage: Tris-based buffer with 50% glycerol at -20°C; avoid repeated freeze-thaw cycles .

  • Applications: Primarily used as an antigen in ELISA to detect S. aureus-specific antibodies or study immune responses .

3.1. Vaccine Development

Adjuvanted recombinant proteins (e.g., CTS, SDD, SAS) have shown efficacy in eliciting γδ T-cell-mediated immunity against S. aureus infections . SAHV_0964 could similarly serve as a vaccine candidate if proven immunogenic.

3.2. Immune Evasion Mechanisms

Proteins like SpA (Protein A) suppress host immunity by binding immunoglobulins . SAHV_0964’s structural motifs warrant investigation into analogous immune-modulatory functions.

3.3. Diagnostic Utility

Recombinant S. aureus proteins (e.g., CHIPS) are used to study bacterial chemotaxis inhibition . SAHV_0964 may aid in developing assays to detect strain-specific antibody responses.

Future Research Priorities

  1. Functional Characterization: Determine SAHV_0964’s role in S. aureus virulence via knockout studies.

  2. Immunogenicity Testing: Evaluate its potential as a vaccine antigen in murine models.

  3. Structural Analysis: Resolve 3D structure to identify binding partners or enzymatic activity.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is finalized during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
SAHV_0964; UPF0344 protein SAHV_0964
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Staphylococcus aureus (strain Mu3 / ATCC 700698)
Target Names
SAHV_0964
Target Protein Sequence
MLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFMLLTLISGFWILIQSFM NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHKMFWITMALIIITMVLGVILPLG PISKLFGIG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0344 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.