Recombinant Staphylococcus aureus UPF0344 protein SAR0931 (SAR0931)

What is SAR0931 and what are its basic structural characteristics?

SAR0931 is a membrane protein from Staphylococcus aureus classified as an UPF0344 family protein. It consists of 129 amino acids with the sequence: MLHLHILSWVLAIILFIATYLNISKNQGGTPYFKPLHMVLRLFMLLTLISGFWILIQSFM NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHTMFWITIALIIITMVLGVILPLG PISKLFGIG . This protein has a UniProt ID of Q6GIB9 and contains predominantly hydrophobic residues consistent with its predicted transmembrane domains . Analysis of the amino acid sequence suggests it has multiple membrane-spanning regions, characteristic of integral membrane proteins.

What expression systems are most effective for producing recombinant SAR0931?

E. coli is the most commonly utilized expression system for recombinant SAR0931 production . For optimal expression, the protein is typically fused to an N-terminal His-tag to facilitate purification. The methodology involves:

• Cloning the SAR0931 gene into an appropriate expression vector

• Transforming the construct into a competent E. coli strain (typically BL21 or derivatives)

• Inducing expression under controlled conditions (temperature, IPTG concentration)

• Harvesting cells and lysing under conditions that preserve membrane protein integrity

• Purifying using Ni-NTA affinity chromatography followed by size exclusion chromatography

Alternative expression systems such as cell-free expression or yeast-based systems may be considered when specific post-translational modifications or higher yields are required.

What purification protocols are recommended for recombinant His-tagged SAR0931?

The purification of His-tagged SAR0931 requires specialized protocols due to its membrane protein nature:

After purification, the protein should be stored at -20°C/-80°C with addition of 5-50% glycerol to prevent aggregation during freeze-thaw cycles .

How stable is purified SAR0931 under various storage conditions?

Purified SAR0931 exhibits variable stability depending on storage conditions. Experimental data indicates:

• For short-term storage (up to one week), the protein remains stable at 4°C in appropriate buffer conditions .

• For long-term storage, maintaining the protein at -20°C/-80°C in the presence of 5-50% glycerol is recommended .

• Repeated freeze-thaw cycles significantly reduce protein activity and structural integrity, necessitating aliquoting prior to freezing .

Stability studies indicate that maintaining the protein in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 provides optimal stability during storage . Researchers should monitor protein integrity using SDS-PAGE and activity assays after storage periods to verify maintained functionality.

What methodologies are most effective for studying SAR0931 membrane topology and insertion?

Multiple complementary approaches can be employed to characterize SAR0931 membrane topology:

• Cysteine scanning mutagenesis: Systematically substituting residues with cysteine and assessing accessibility to membrane-impermeable thiol-reactive reagents.

• Proteolytic digestion mapping: Limited proteolysis of membrane-embedded protein followed by mass spectrometry analysis of accessible regions.

• Fluorescence spectroscopy: Incorporating environment-sensitive fluorophores at specific positions to monitor membrane insertion.

• Spin-labeling techniques: Similar to those employed for Na+/K+-ATPase studies, benzoylvinyl nitroxide derivatives can be used to label specific residues, providing advantages over conventional maleimide nitroxide derivatives due to reduced segmental mobility . This approach allows for detailed investigation of protein rotational diffusion using saturation transfer ESR spectroscopy.

• Molecular dynamics simulations: In silico prediction of membrane insertion based on hydrophobicity analysis and energy minimization.

These methods should be used in combination to develop a consensus model of SAR0931 topology.

How can one assess the oligomerization state of SAR0931 in membrane environments?

Determining the oligomerization state of membrane proteins like SAR0931 requires specialized techniques:

• Chemical cross-linking: Using bifunctional cross-linkers of varying lengths to capture protein-protein interactions, followed by SDS-PAGE and mass spectrometry analysis.

• Blue native PAGE: Non-denaturing electrophoresis to preserve native protein complexes.

• Analytical ultracentrifugation: Sedimentation velocity and equilibrium experiments with detergent-solubilized protein.

• FRET analysis: Labeling protein subunits with donor/acceptor fluorophores to detect proximity-dependent energy transfer.

• Saturation transfer ESR spectroscopy: This technique has been successfully applied to study oligomerization of other membrane proteins such as Na+/K+-ATPase, which was found to exist as an (alpha beta)2-diprotomer or higher oligomer in native membranes . The integral of the saturation-transfer spectrum provides sensitive detection of segmental motion compared to line-height ratios .

• Single-molecule tracking: Advanced microscopy techniques to observe protein diffusion and clustering in reconstituted systems.

What approaches can be used to identify potential interaction partners of SAR0931?

Identification of SAR0931 interaction partners requires multi-faceted experimental strategies:

• Co-immunoprecipitation: Using anti-His antibodies to pull down SAR0931 complexes from solubilized membranes.

• Bacterial two-hybrid systems: Modified for membrane protein screening.

• Label transfer approaches: Using photo-activatable or chemical cross-linkers.

• Proximity-dependent biotin identification (BioID): Fusion of SAR0931 with a promiscuous biotin ligase.

• Quantitative proteomics: Comparative analysis of protein complexes isolated from wild-type versus SAR0931-deficient strains.

• Reconstitution studies: Co-reconstitution of purified SAR0931 with candidate interactors in liposomes or nanodiscs.

Each approach has specific strengths and limitations, necessitating multiple methods to confidently identify physiologically relevant interactions.

What reconstitution methods are optimal for functional studies of SAR0931?

Reconstitution of SAR0931 into membrane mimetics requires careful optimization:

For functional studies, researchers should verify protein incorporation using freeze-fracture electron microscopy or fluorescence-based assays. The choice of lipid composition significantly impacts protein stability and activity, with mixtures mimicking S. aureus membrane composition often providing optimal results.

How can site-directed spin labeling be optimized for studying SAR0931 dynamics?

Site-directed spin labeling (SDSL) of SAR0931 can be optimized using approaches similar to those employed for other membrane proteins:

This approach allows for detailed characterization of protein dynamics in membrane environments.

What controls are essential when designing functional assays for SAR0931?

Rigorous experimental controls are critical for reliable functional characterization:

• Protein quality controls:

  • SDS-PAGE and Western blotting to verify purity (>90% as determined by SDS-PAGE)

  • Circular dichroism to confirm secondary structure

  • Dynamic light scattering to assess homogeneity

• Activity assay controls:

  • Heat-inactivated protein samples

  • Competitive inhibitors if known

  • Empty vesicles/membranes without SAR0931

• Specificity controls:

  • Non-functional mutants (point mutations in predicted active sites)

  • Related proteins from the same family

  • Substrate analogs or competitors

• Environmental controls:

  • Buffer composition variations

  • Temperature dependence studies

  • pH profiles of activity

• Reconstitution efficiency controls:

  • Protein:lipid ratio quantification

  • Orientation-specific assays

  • Freeze-fracture electron microscopy

Each experimental setup requires optimization and validation to ensure reproducibility and physiological relevance.

How can one determine if specific post-translational modifications occur on SAR0931?

Investigation of post-translational modifications (PTMs) on SAR0931 requires systematic analytical approaches:

• Mass spectrometry-based methods:

  • Bottom-up proteomics: Enzymatic digestion followed by LC-MS/MS

  • Top-down proteomics: Analysis of intact protein

  • Targeted approaches for specific modifications

• Modification-specific detection:

  • Phosphorylation: Pro-Q Diamond staining, phospho-specific antibodies

  • Glycosylation: Periodic acid-Schiff staining, lectin affinity

  • Lipidation: Click chemistry with metabolic labeling

• Site-directed mutagenesis:

  • Mutation of predicted modification sites

  • Functional assessment of mutants

• Bioinformatic prediction:

  • NetPhos for phosphorylation

  • NetNGlyc/NetOGlyc for glycosylation

  • GPS-Lipid for lipidation sites

When working with recombinant SAR0931, researchers should consider that E. coli expression systems may not reproduce the native PTM profile found in S. aureus, necessitating comparison with protein isolated from the native organism.

What techniques are available for studying the interaction of SAR0931 with lipid environments?

The interaction between SAR0931 and membrane lipids can be investigated using:

• Differential scanning calorimetry (DSC): Measures thermotropic phase transitions in lipid membranes containing SAR0931.

• Fluorescence anisotropy: Evaluates lipid ordering in the vicinity of the protein.

• Deuterium NMR: Provides detailed information on lipid acyl chain dynamics.

• Langmuir monolayer techniques: Assesses protein insertion into lipid films.

• Saturation transfer ESR spectroscopy: Used in lipid-protein interaction studies with other membrane proteins like Na+/K+-ATPase , this technique can provide insights into the lipid environment surrounding SAR0931.

• Atomic force microscopy: Visualizes protein distribution and clustering in supported bilayers.

• Lipid mass spectrometry: Identifies specific lipids co-purifying with the protein.

These approaches should be combined to develop a comprehensive model of how SAR0931 interacts with and potentially modifies its lipid environment.

How can SAR0931 be used as a target for developing anti-Staphylococcus therapeutics?

Developing therapeutics targeting SAR0931 requires a systematic approach:

• Target validation:

  • Gene knockout/knockdown studies in S. aureus

  • Assessment of phenotypic consequences

  • Determination of essentiality under various conditions

• High-throughput screening:

  • Development of functional assays amenable to HTS

  • Screening of compound libraries against purified SAR0931

  • Counter-screening against mammalian homologs to assess selectivity

• Structure-based drug design:

  • Identification of druggable pockets

  • In silico screening of virtual compound libraries

  • Fragment-based approaches using NMR or X-ray crystallography

• Validation of hits:

  • Biochemical confirmation of binding

  • Determination of mechanism of action

  • Assessment of antibacterial activity against S. aureus strains

• Medicinal chemistry optimization:

  • SAR studies to improve potency and selectivity

  • Pharmacokinetic and toxicity profiling

  • Resistance development assessment

This multi-faceted approach maximizes the potential for identifying clinically relevant inhibitors.

What role might SAR0931 play in Staphylococcus aureus pathogenicity?

Understanding SAR0931's potential role in pathogenicity requires multiple investigative approaches:

• Expression analysis:

  • qPCR quantification under various infection-relevant conditions

  • Proteomic profiling during host-pathogen interaction

  • Single-cell studies to assess expression heterogeneity

• Mutant phenotyping:

  • Construction of deletion and conditional mutants

  • Assessment of virulence in infection models

  • Analysis of biofilm formation and antibiotic tolerance

• Host interaction studies:

  • Evaluation of immune recognition of SAR0931

  • Assessment of inflammatory responses

  • Identification of host targets or receptors

• Comparative genomics:

  • Analysis of sequence conservation across clinical isolates

  • Identification of variants associated with hypervirulent strains

  • Evaluation of selection pressure on the SAR0931 gene

These studies can establish whether SAR0931 represents a potential virulence factor or contributes to pathogenicity through other mechanisms.

How does SAR0931 expression vary across different Staphylococcus aureus strains and growth conditions?

Systematic analysis of SAR0931 expression patterns reveals:

Expression profiling across clinical isolates shows variable patterns, suggesting strain-specific regulatory mechanisms. Researchers should employ multiple detection methods and standardized growth conditions when comparing expression levels between experiments or studies.