Recombinant Staphylococcus aureus UPF0344 protein SAS0839 (SAS0839)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
SAS0839; UPF0344 protein SAS0839
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Staphylococcus aureus (strain MSSA476)
Target Names
SAS0839
Target Protein Sequence
MLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFMLLTLISGFWILIQSFM NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHKMFWITMALIIITMVLGVILPLG PISKLFGIG
Uniprot No.

Target Background

Database Links

KEGG: sas:SAS0839

Protein Families
UPF0344 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Staphylococcus aureus UPF0344 protein SAS0839?

Staphylococcus aureus UPF0344 protein SAS0839 is a protein encoded by the SAS0839 gene in Staphylococcus aureus strain MSSA476. The protein belongs to the UPF0344 family and consists of 129 amino acids with the sequence mLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFmLLTLISGFWILIQSFMNGGANHmLLTLKmLCGVAVVGLMEVSIAKRKRHEQSHKMFWITMALIIITMVLGVILPLGPISKLFGIG . The UniProt accession number for this protein is Q6GAV7, and its structure has been computationally modeled rather than experimentally determined .

What is the predicted structure and function of SAS0839?

The structure of UPF0344 protein SAS0839 has been computationally modeled, but not experimentally verified. According to the computed structure model in the RCSB Protein Data Bank (ID: AF_AFQ7A6H2F1), the protein's structure provides insights into its potential functional domains . While specific functions haven't been fully characterized, sequence analysis suggests it may be a membrane-associated protein, given the presence of hydrophobic regions indicative of transmembrane domains in its amino acid sequence .

How does SAS0839 relate to Staphylococcus aureus pathogenicity?

While direct evidence linking SAS0839 to Staphylococcus aureus pathogenicity isn't explicitly mentioned in the available search results, research on S. aureus virulence factors identifies several key proteins involved in pathogenicity. The development of vaccines against S. aureus typically targets conserved antigens including secreted factors like α-hemolysin (Hla), staphylococcal enterotoxin B (SEB), and surface proteins such as staphylococcal protein A (SpA), iron surface determinant B N2 domain (IsdB-N2), and manganese transport protein C (MntC) . Understanding the role of SAS0839 in relation to these established virulence factors requires additional research.

What are the recommended approaches for expressing and purifying recombinant SAS0839 protein?

Recombinant expression of Staphylococcus aureus proteins typically involves selecting an appropriate expression system, optimizing codon usage, and establishing efficient purification protocols. For SAS0839, researchers should consider:

  • Expression system selection: Bacterial expression systems like E. coli are commonly used for S. aureus proteins, though eukaryotic systems may be necessary if post-translational modifications are critical.

  • Protein tagging: Adding affinity tags (His-tag, GST, etc.) facilitates purification. The commercial recombinant SAS0839 notes that "tag type will be determined during production process" .

  • Optimization of solubility: Given the hydrophobic regions in SAS0839, special attention should be paid to solubility during expression and purification.

  • Storage conditions: Once purified, the protein should be stored in appropriate buffer conditions. Commercial preparations recommend storage in "Tris-based buffer with 50% glycerol optimized for this protein" at -20°C or -80°C for extended storage .

What experimental design considerations are important when studying SAS0839 function?

Designing rigorous experiments to investigate SAS0839 function requires careful planning:

  • Variable identification: Clearly define independent variables (e.g., protein concentration, experimental conditions) and dependent variables (e.g., binding affinity, cellular response) to establish causality .

  • Hypothesis formulation: Develop specific, testable hypotheses about SAS0839 function based on structural predictions and preliminary data .

  • Control implementation: Include appropriate positive and negative controls to validate experimental outcomes and minimize the influence of confounding variables .

  • Replication strategy: Plan for biological and technical replicates to ensure statistical robustness and reproducibility of findings .

  • Measurement precision: Select appropriate techniques for measuring protein-protein interactions, enzymatic activity, or cellular effects with sufficient sensitivity and specificity .

The following table outlines key experimental design elements for SAS0839 functional studies:

Experimental Design ElementImplementation for SAS0839 Research
Research question formulationSpecific, focused questions about SAS0839 function
Variable definitionIndependent: protein concentration, experimental conditions
Dependent: binding affinity, cellular response
Control selectionPositive controls: known S. aureus proteins
Negative controls: buffer-only, unrelated proteins
Replication approachMinimum 3 biological replicates, 3 technical replicates
Statistical analysis planAppropriate statistical tests based on data distribution

How can SAS0839 be incorporated into vaccine development research against S. aureus?

Incorporating SAS0839 into vaccine research would follow methodologies similar to those used in developing the recombinant five-antigen S. aureus vaccine (rFSAV). Key considerations include:

  • Antigen evaluation: Assess SAS0839 conservation across S. aureus strains to determine its potential as a broadly protective antigen .

  • Immunogenicity testing: Evaluate the ability of SAS0839 to elicit robust antibody and T-cell responses in animal models .

  • Combination strategies: Consider including SAS0839 with established antigens (like those in rFSAV) to potentially enhance protection through targeting multiple virulence mechanisms .

  • Protection assessment: Test vaccine formulations containing SAS0839 in relevant animal models of S. aureus infection, including lethal sepsis and pneumonia models .

  • Immune response characterization: Thoroughly evaluate both cellular and humoral immune responses to determine protective mechanisms .

The rFSAV approach demonstrated that combining multiple antigens provided consistent protection against various S. aureus strains and infection models, suggesting that a multi-component approach that potentially includes SAS0839 could be beneficial .

What approaches can be used to analyze seemingly contradictory data about SAS0839 function?

When confronting contradictory findings about SAS0839 function, researchers should implement systematic approaches to resolve discrepancies:

  • Context analysis: Examine experimental contexts thoroughly, as contradictions often arise from underspecified conditions. Variations in species, temporal context, or environmental conditions can significantly impact protein function .

  • Normalization procedures: Ensure consistent normalization of genetic and protein nomenclature across studies to avoid misinterpretation of results due to terminology differences .

  • Relation categorization: Categorize reported functional relationships (e.g., excitatory, inhibitory) to identify true contradictions versus complementary findings .

  • Structured comparison: Analyze contradictory claims using a framework that examines:

    • Experimental models used (in vitro vs. in vivo)

    • Methodological differences

    • Reagent variations (including protein tags and purification methods)

    • Data interpretation approaches

  • Meta-analysis techniques: Apply formal meta-analysis when sufficient data exist across multiple studies to determine consensus findings .

How does research on SAS0839 complement broader S. aureus virulence studies?

Research on SAS0839 can be integrated into the broader context of S. aureus virulence studies by:

  • Comparative genomics: Analyzing the conservation and variation of the SAS0839 gene across clinical and environmental S. aureus isolates to understand evolutionary pressure and functional importance.

  • Interactome analysis: Investigating potential interactions between SAS0839 and known virulence factors such as Hla, SEB, SpA, IsdB-N2, and MntC to establish functional networks .

  • Expression profiling: Examining SAS0839 expression patterns during different stages of infection and in response to host defense mechanisms.

  • Knockout studies: Evaluating the impact of SAS0839 deletion on S. aureus virulence in relevant infection models to determine its contribution to pathogenicity.

  • Structural biology approaches: Using the computational model of SAS0839 as a starting point for experimental structure determination and structure-function relationship studies.

What methodological considerations are important when designing studies to examine SAS0839 role in antibiotic resistance?

To investigate potential connections between SAS0839 and antibiotic resistance, researchers should consider:

  • Expression correlation analysis: Examine correlations between SAS0839 expression levels and minimum inhibitory concentrations (MICs) for various antibiotics across S. aureus isolates.

  • Resistance mechanism investigation: Determine if SAS0839 contributes to specific resistance mechanisms such as cell wall modifications, efflux pump regulation, or altered metabolic pathways.

  • Structural interaction studies: Investigate potential direct interactions between SAS0839 and antibiotics using techniques such as surface plasmon resonance or isothermal titration calorimetry.

  • Genetic manipulation approaches: Create SAS0839 knockout or overexpression strains to assess changes in antibiotic susceptibility patterns.

  • Time-course experiments: Monitor changes in SAS0839 expression during antibiotic exposure to identify potential regulatory roles in stress response.

What statistical approaches are recommended for analyzing SAS0839 functional data?

When analyzing experimental data related to SAS0839 function, researchers should implement robust statistical methodologies:

  • Descriptive statistics: Begin with appropriate measures of central tendency and dispersion, considering data distribution characteristics.

  • Hypothesis testing: Select appropriate statistical tests based on experimental design and data properties (parametric vs. non-parametric).

  • Multiple comparisons correction: Apply corrections (e.g., Bonferroni, Benjamini-Hochberg) when performing multiple statistical tests to control false discovery rates.

  • Effect size estimation: Report effect sizes alongside p-values to provide information about the magnitude of observed effects.

  • Power analysis: Conduct power analyses during experimental design to ensure adequate sample sizes for detecting biologically meaningful effects.

  • Reproducibility verification: Implement statistical approaches that enhance reproducibility, including detailed reporting of all analysis parameters and data transformations .

How can research methodology ensure reliable characterization of SAS0839?

To ensure reliable characterization of SAS0839, researchers should implement comprehensive methodology considerations:

  • Structured research approach: Follow the systematic steps outlined in research methodology frameworks: define research questions, select appropriate methods, implement controlled experiments, analyze data objectively, and interpret findings within established knowledge .

  • Method validation: Validate all experimental methods used to characterize SAS0839, including protein expression systems, purification techniques, and functional assays.

  • Quality control measures: Implement rigorous quality control procedures for recombinant protein production, ensuring batch consistency through techniques like SDS-PAGE, mass spectrometry, and activity assays.

  • Data triangulation: Characterize SAS0839 using multiple complementary techniques (e.g., structural, biochemical, and cellular approaches) to build a comprehensive understanding.

  • Transparent reporting: Document all methodological details, including experimental conditions, reagent sources, and analytical procedures, to enable replication by other researchers .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.