Recombinant Staphylococcus aureus UPF0344 protein SaurJH1_0988 (SaurJH1_0988)

Shipped with Ice Packs
In Stock

Description

Molecular and Genomic Context

Gene locus: SaurJH1_0988 is located at coordinates 3,470,090–3,470,479 on the forward strand of S. aureus JH1’s genome .
Conservation:

  • Found in 100% of 34 analyzed S. aureus strains .

  • Orthologs include SAUV_0964 (Mu3 strain) and USA300HOU_0928 (USA300_TCH1516 strain) .

Domain features:

  • DUF1516 domain (function uncharacterized).

  • Predicted membrane localization .

Functional and Research Insights

While SaurJH1_0988 remains uncharacterized experimentally, its genomic and structural features suggest potential roles:

  • Membrane association: Predicted involvement in transport or signaling due to transmembrane domains .

  • Conservation: Universal presence across S. aureus strains implies essentiality in basic cellular processes .

Related findings:

  • UPF0344 family proteins in S. aureus are upregulated under skin-like conditions, correlating with virulence factor expression .

  • S. aureus proteases and lipases (e.g., lipase 1) enhance viral replication in coinfection models, though no direct link to SaurJH1_0988 exists .

Applications

  • Antigen development: Used in antibody production due to its surface-exposed epitopes .

  • Structural studies: Solubility-optimized versions aid in crystallography or NMR .

  • Pathogenesis research: Hypothesized role in host-pathogen interactions warrants further study .

Limitations and Future Directions

  • Functional ambiguity: No direct evidence links SaurJH1_0988 to specific biochemical pathways .

  • Activity assays: Bioactivity or enzymatic function remains unverified .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SaurJH1_0988; UPF0344 protein SaurJH1_0988
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Staphylococcus aureus (strain JH1)
Target Names
SaurJH1_0988
Target Protein Sequence
MLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFMLLTLISGFWILIQSFM NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHKMFWITMALIIITMVLGVILPLG PISKLFGIG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0344 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the SaurJH1_0988 protein and what is currently known about its function?

SaurJH1_0988 is an uncharacterized protein (UPF0344 family) from Staphylococcus aureus strain JH1. As an uncharacterized protein, its precise biological function remains to be fully elucidated. Current evidence suggests it may be involved in bacterial cellular processes, though specific pathways are still under investigation. The protein belongs to a family of bacterial proteins that share similar structural elements but whose functions remain largely unknown across different bacterial species.

To determine potential functions, researchers should consider:

  • Bioinformatic analysis of sequence homology with characterized proteins

  • Structural prediction tools like AlphaFold2

  • Gene neighborhood analysis to identify functional associations

  • Expression pattern analysis during different growth phases and stress conditions

What expression systems are most effective for producing recombinant SaurJH1_0988?

The expression of full-length SaurJH1_0988 can be achieved through several systems, each with advantages depending on research needs:

E. coli-based expression:

  • BL21(DE3) strain often provides high yields for non-toxic bacterial proteins

  • Codon optimization may be necessary as S. aureus has different codon usage than E. coli

  • Fusion tags (His6, GST, or MBP) can improve solubility and facilitate purification

  • Low temperature induction (16-18°C) typically improves proper folding

Alternative expression systems:

  • Gram-positive systems like B. subtilis may provide better folding for S. aureus proteins

  • Mammalian cell expression for studying host-pathogen interactions

  • Cell-free systems for rapid small-scale production

When facing expression challenges, consider analyzing the protein's hydrophobicity profile and secondary structure prediction to optimize conditions. For potentially membrane-associated proteins, detergent screening may be necessary during purification .

How can I confirm the full-length expression of SaurJH1_0988?

Confirming full-length expression is critical for functional studies. Implement these methodological approaches:

  • Dual-tagging strategy: Use expression vectors with different tags at N- and C-termini (e.g., His-tag at N-terminus and FLAG-tag at C-terminus) to ensure only full-length proteins contain both tags

  • Western blot analysis: Probe with antibodies against both terminal tags

  • Mass spectrometry: Perform peptide mass fingerprinting to confirm complete sequence coverage

  • Size-exclusion chromatography: Compare elution profile with theoretical molecular weight

When using immobilized metal affinity chromatography (IMAC), gradually increase imidazole concentration during elution to separate truncated products from full-length protein .

What purification strategy yields the highest purity of SaurJH1_0988?

A multi-step purification approach typically yields the highest purity:

Step 1: Initial capture

  • For His-tagged constructs: IMAC with Ni-NTA or Co-NTA resin

  • For GST-tagged constructs: Glutathione-Sepharose chromatography

Step 2: Intermediate purification

  • Ion exchange chromatography based on theoretical pI of SaurJH1_0988

  • Hydrophobic interaction chromatography

Step 3: Polishing

  • Size exclusion chromatography to remove aggregates and achieve >95% purity

  • Consider tag removal with appropriate protease if the tag may interfere with function

Purity assessment methods:

  • SDS-PAGE with Coomassie or silver staining (aim for >95% purity)

  • Analytical SEC-HPLC

  • Mass spectrometry

How can I determine if SaurJH1_0988 plays a role in S. aureus virulence or antibiotic resistance?

Investigating the role of SaurJH1_0988 in virulence requires multiple complementary approaches:

Genetic approaches:

  • Generate knockout mutants using CRISPR-Cas9 or allelic replacement

  • Create complemented strains to confirm phenotypes

  • Construct conditional expression strains for essential genes

Virulence model systems:

  • Compare wild-type and mutant strains in established infection models

  • Test for changes in biofilm formation capacity

  • Evaluate persistence in phagocytic cells

Antibiotic resistance testing:

  • Determine minimum inhibitory concentrations (MICs) for mutant vs. wild-type

  • Assess stress responses to environmental challenges

One particularly valuable approach is transcriptomic analysis comparing gene expression profiles between wild-type and SaurJH1_0988 knockout strains under various conditions, including antibiotic exposure and host-mimicking environments .

Could SaurJH1_0988 serve as a potential vaccine target against S. aureus infections?

Evaluating SaurJH1_0988 as a vaccine candidate requires systematic investigation:

Antigen properties assessment:

  • Surface accessibility analysis via computational prediction and experimental verification

  • Conservation analysis across clinical S. aureus isolates (both MRSA and MSSA strains)

  • Expression levels during different infection stages

Immunological evaluation:

  • Determine antibody titers elicited against recombinant SaurJH1_0988

  • Assess functional antibody responses (opsonophagocytic activity)

  • Evaluate T cell responses, particularly Th1 and Th17 responses which have been associated with protection against S. aureus

It's important to note that past S. aureus vaccine failures have demonstrated that opsonophagocytosis alone is not sufficient as a predictor of vaccine efficacy. Multiple immunological readouts should be evaluated, including cellular immunity components .

Experimental design considerations:

  • Combine SaurJH1_0988 with other S. aureus antigens for broader protection

  • Consider conjugation to staphylococcal carrier proteins rather than heterologous carriers

  • Test multiple adjuvants, particularly those that induce robust Th1/Th17 responses like CpG oligonucleotides

What structural characteristics of SaurJH1_0988 might inform its function?

Structural analysis provides critical insights into potential functions:

Computational structure prediction:

  • AlphaFold2 or RoseTTAFold predictions of tertiary structure

  • Identification of conserved domains and motifs

  • Prediction of potential binding sites or catalytic regions

Experimental structure determination:

  • X-ray crystallography of purified recombinant protein

  • NMR spectroscopy for dynamic structural elements

  • Cryo-EM for larger complexes

Structure-function analysis:

  • Site-directed mutagenesis of predicted functional residues

  • Chimeric protein construction with homologous domains

  • Binding partner identification through pull-down assays coupled with mass spectrometry

Structural insights should be integrated with transcriptomic and proteomic data to develop testable hypotheses about the protein's role in S. aureus biology .

How does SaurJH1_0988 expression change during different phases of S. aureus infection?

Understanding expression patterns provides valuable context for functional studies:

In vitro expression analysis:

  • qRT-PCR during different growth phases (lag, log, stationary)

  • Western blot analysis with specific antibodies

  • Reporter gene constructs (e.g., GFP fusion) to monitor real-time expression

Expression under infection-relevant conditions:

  • Biofilm vs. planktonic growth

  • Responses to host-derived antimicrobial peptides

  • Adaptation to varying oxygen tensions

  • Nutrient limitation conditions

In vivo expression studies:

  • RNA-seq from infected tissues

  • In vivo imaging with reporter strains

  • Immunohistochemistry of infected tissues

Growth ConditionRelative Expression LevelAssociated Phenotypes
Exponential phase (rich media)BaselineStandard laboratory growth
Stationary phaseMay increase if stress-responsivePersistence mechanisms
Biofilm formationOften upregulated in matrix proteinsAntibiotic tolerance
Intracellular (post-phagocytosis)Variable based on functionImmune evasion
In vivo infectionContext-dependentVirulence expression

Note: This table represents a methodological framework for expression analysis rather than specific data for SaurJH1_0988, which would need to be experimentally determined.

What approaches can identify potential interaction partners of SaurJH1_0988?

Identifying protein-protein interactions will provide functional insights:

Affinity-based methods:

  • Pull-down assays using tagged recombinant SaurJH1_0988

  • Co-immunoprecipitation with specific antibodies

  • Bacterial two-hybrid systems

Proximity-based approaches:

  • BioID or APEX2 proximity labeling in engineered S. aureus

  • Cross-linking mass spectrometry (XL-MS)

  • Fluorescence resonance energy transfer (FRET)

Global interactome analysis:

  • Protein microarrays with the S. aureus proteome

  • Label-free quantitative proteomics

For each identified interaction, validation through multiple orthogonal methods is essential to eliminate false positives, which are common in interaction studies.

How can I assess the impact of SaurJH1_0988 on host-pathogen interactions?

Understanding host-pathogen interactions requires both in vitro and in vivo approaches:

Cellular models:

  • Infection of relevant host cells (neutrophils, macrophages, epithelial cells)

  • Comparison of wild-type vs. knockout bacterial strains

  • Analysis of host cell responses (cytokine production, phagocytosis efficiency)

Functional assays:

  • Adhesion to host matrix proteins

  • Invasion assays in non-phagocytic cells

  • Persistence within phagocytes

  • Cytotoxicity measurements

Immune response evaluation:

  • Cytokine/chemokine profiling in response to purified protein

  • Neutrophil extracellular trap (NET) formation

  • Activation of pattern recognition receptors

When designing these experiments, it's crucial to consider that S. aureus employs multiple strategies for immune evasion and may target various host cell types differently .

What approaches can determine if SaurJH1_0988 is involved in antibiotic resistance mechanisms?

Methodologies to investigate potential roles in antibiotic resistance:

Genetic approaches:

  • Overexpression studies to identify potential resistance phenotypes

  • Gene deletion and complementation studies

  • Transposon mutagenesis with antibiotic selection

Biochemical assays:

  • Direct interaction studies with antibiotics

  • Enzymatic activity assays (if hydrolytic activity is predicted)

  • Membrane permeability assessments

Clinical correlation:

  • Expression analysis in resistant vs. susceptible clinical isolates

  • SNP analysis across strain collections with varied resistance profiles

How can I develop robust assays to measure SaurJH1_0988 activity?

Developing functional assays depends on hypothesized protein function:

For potential enzymatic activity:

  • Substrate screening based on structural predictions

  • Coupled enzyme assays for detecting reaction products

  • Isothermal titration calorimetry for binding kinetics

For structural proteins:

  • Electron microscopy to visualize cellular localization

  • Atomic force microscopy for mechanical properties

  • Fluorescence recovery after photobleaching (FRAP) for mobility assessment

For regulatory proteins:

  • Electrophoretic mobility shift assays (EMSA) for DNA binding

  • Reporter gene assays for transcriptional regulation

  • RNA immunoprecipitation for RNA binding

How can I overcome solubility issues when expressing recombinant SaurJH1_0988?

Solubility challenges require systematic optimization approaches:

Expression condition modifications:

  • Lower induction temperature (16-18°C)

  • Reduced inducer concentration

  • Co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ)

Construct optimization:

  • Fusion to highly soluble partners (MBP, SUMO, Thioredoxin)

  • Truncation constructs based on domain prediction

  • Surface entropy reduction mutagenesis

Solubilization strategies:

  • Screening of detergents for membrane-associated proteins

  • Addition of stabilizing agents (glycerol, arginine, trehalose)

  • Refolding protocols from inclusion bodies

The choice of strategy should be guided by bioinformatic analysis of protein properties, including hydrophobicity profiles and secondary structure predictions .

What are the best practices for storing purified SaurJH1_0988 to maintain activity?

Appropriate storage conditions are essential for maintaining protein functionality:

Short-term storage (1-2 weeks):

  • 4°C with protease inhibitors

  • Sterile filtration to prevent microbial contamination

Medium-term storage (1-3 months):

  • -20°C with 10-25% glycerol

  • Aliquoting to avoid freeze-thaw cycles

Long-term storage (>3 months):

  • -80°C in small aliquots

  • Lyophilization for maximum stability

Stability optimization:

  • Buffer screening (pH, ionic strength, additives)

  • Thermal shift assays to identify stabilizing conditions

  • Activity measurements after various storage periods

How can I troubleshoot non-specific binding in interaction studies with SaurJH1_0988?

Non-specific binding is a common challenge in protein interaction studies:

Optimization strategies:

  • Increase stringency of washing buffers (higher salt, mild detergents)

  • Pre-clear lysates with bare beads

  • Use competing agents (BSA, casein) in binding buffers

Control experiments:

  • Include non-relevant proteins with similar properties

  • Perform binding with denatured SaurJH1_0988

  • Test mutated versions of interaction sites

Alternative approaches:

  • Switch affinity tag systems

  • Use crosslinking to capture transient interactions

  • Employ label-free interaction systems (SPR, BLI)

How might SaurJH1_0988 fit into the broader context of S. aureus vaccine development?

Current S. aureus vaccine development faces significant challenges that new antigen discovery might address:

Current vaccine landscape:

  • Previous vaccine candidates (StaphVax, V710, SA4Ag) have failed in clinical trials despite inducing opsonophagocytic antibodies

  • Growing consensus that multi-antigen approaches are needed

  • Increasing focus on T cell immunity, particularly Th1 and Th17 responses

Integration possibilities for SaurJH1_0988:

  • As part of multi-antigen formulations if sufficiently immunogenic

  • Potential conjugation partner with capsular polysaccharides

  • Component in attenuated live vaccine platforms

Evaluation framework:

  • Conservation analysis across clinical isolates

  • Immunogenicity in animal models

  • Protection in relevant infection models

  • Combined efficacy with established antigens

Recent research has demonstrated that "designer" glycoconjugates containing multiple S. aureus antigens show superior immunogenicity compared to those using carrier proteins from unrelated bacteria .

What role might SaurJH1_0988 play in developing alternative therapeutics beyond vaccines?

Beyond vaccines, several therapeutic approaches might leverage insights from SaurJH1_0988 research:

Monoclonal antibody development:

  • Identification of neutralizing epitopes

  • Antibody engineering for enhanced effector functions

  • Potential for antibody-antibiotic conjugates

Small molecule inhibitors:

  • Structure-based drug design if functionally important

  • High-throughput screening against SaurJH1_0988 activity

  • Fragment-based lead discovery

Alternative approaches:

  • Bacteriophage-based therapies targeting processes involving SaurJH1_0988

  • Protein-protein interaction disruptors

  • CRISPR-Cas antimicrobials targeting the encoding gene

The landscape of alternative S. aureus therapeutics has expanded to include bacteriophage therapies, which have shown preliminary efficacy in treating MRSA infections, achieving response rates of over 42% in some clinical settings .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.