Recombinant Staphylococcus aureus UPF0344 protein SaurJH9_0969 (SaurJH9_0969)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

SaurJH9_0969 is classified under the UPF0344 family of uncharacterized bacterial proteins. Key features include:

PropertyDetails
Gene LocusSaurJH9_0969
Source OrganismStaphylococcus aureus (strain JH9)
Uniprot IDA5IRE7
Amino Acid Sequence Length1–129 residues
Expression HostsE. coli, yeast, baculovirus, or mammalian cell systems
Purity≥85% (verified via SDS-PAGE)
StorageTris-based buffer with 50% glycerol at -20°C/-80°C

The protein's sequence includes conserved domains typical of UPF0344 proteins, though its exact biochemical function remains unconfirmed .

2.1. Recombinant Production

SaurJH9_0969 is synthesized using heterologous expression systems, primarily:

  • Expression Hosts: Optimized for high yield in E. coli, yeast, or mammalian cells .

  • Purification: Affinity chromatography followed by buffer exchange for stability .

Comparative Analysis of UPF0344 Proteins

UPF0344 proteins across S. aureus strains share structural homology but differ in gene nomenclature:

StrainGene NameHost SystemApplication
JH9SaurJH9_0969E. coli/MammalianVaccine research
JH1SaurJH1_0988E. coliHypothetical protein studies
USA300HOUUSA300HOU_0928Cell-free expressionStructural analysis

These variants are used to study strain-specific adaptations and virulence mechanisms .

Research Gaps and Challenges

  • Functional Annotation: The role of SaurJH9_0969 in S. aureus metabolism or pathogenicity is unconfirmed .

  • Therapeutic Potential: No clinical trials target UPF0344 proteins, partly due to challenges in distinguishing bacterial from human homologs .

  • Commercial Limitations: Available recombinant SaurJH9_0969 is restricted to non-clinical research .

Future Directions

  • Mechanistic Studies: CRISPR-based knockout models could clarify its role in bacterial survival or immune evasion .

  • Multi-Omics Integration: Linking SaurJH9_0969 expression profiles with proteomic datasets may reveal novel pathways .

  • Adjuvant Synergy: Testing recombinant SaurJH9_0969 with TLR agonists could enhance vaccine efficacy .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please communicate this to us, and we will prioritize developing the specified tag.
Synonyms
SaurJH9_0969; UPF0344 protein SaurJH9_0969
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Staphylococcus aureus (strain JH9)
Target Names
SaurJH9_0969
Target Protein Sequence
MLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFMLLTLISGFWILIQSFM NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHKMFWITMALIIITMVLGVILPLG PISKLFGIG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0344 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Staphylococcus aureus UPF0344 protein SaurJH9_0969?

Staphylococcus aureus UPF0344 protein SaurJH9_0969 (SaurJH9_0969) is a protein derived from Staphylococcus aureus strain JH9, belonging to the UPF0344 protein family . Staphylococcus aureus is a Gram-positive, round-shaped bacterium that belongs to the Firmicutes phylum and is commonly found in the upper respiratory tract and on human skin . The protein is currently classified as having unknown function (UPF), indicating that its precise biological role and molecular mechanisms are still being investigated in current research . The protein consists of 129 amino acids and is being studied for potential applications in vaccine development and understanding of S. aureus pathogenicity .

What purification strategies are effective for recombinant S. aureus proteins?

Effective purification strategies for recombinant S. aureus proteins typically involve affinity chromatography techniques similar to those used for Protein A purification . For SaurJH9_0969, researchers might employ techniques such as immobilized metal affinity chromatography (IMAC) if the recombinant protein is expressed with a histidine tag . A common approach involves initial capture of the protein from the culture medium or cell lysate, followed by multiple washing steps, and elution under specific pH conditions . For instance, with Protein A, purification involves binding to IgG-agarose affinity resin at pH 7.5, followed by washing and elution with 0.1 M acetic acid at pH 2.4 . Researchers should be mindful that for SaurJH9_0969, maintaining appropriate pH during purification is critical, as extreme pH conditions (particularly above pH 8) may denature the protein structure .

How should SaurJH9_0969 protein samples be stored for optimal stability?

For optimal stability of SaurJH9_0969 protein samples, researchers should follow storage protocols similar to those established for other S. aureus proteins . Based on established practices for S. aureus proteins, storage at 2-8°C is recommended for short-term preservation . For long-term storage, maintaining the protein in working aliquots at neutral pH and storing them frozen would provide good solution stability . It's important to avoid pH conditions greater than 8, as alkaline conditions may denature the protein and result in poor solution stability . When preparing the protein for storage, a concentration of approximately 1 mg/ml in appropriate buffer would be suitable, based on solubility parameters of related proteins . Researchers should verify the stability of SaurJH9_0969 under different storage conditions through analytical methods such as SDS-PAGE or functional assays before establishing standard laboratory protocols.

What structural and functional characteristics define the UPF0344 protein family?

The UPF0344 protein family, to which SaurJH9_0969 belongs, is characterized by its unique structural properties that remain incompletely characterized in current literature . Unlike well-characterized S. aureus proteins such as Protein A (which contains four repetitive domains rich in aspartic and glutamic acids), the structural domains of UPF0344 proteins require further elucidation through techniques such as X-ray crystallography or NMR spectroscopy . Functional characterization of UPF0344 proteins presents significant challenges due to their unknown function designation . Researchers investigating SaurJH9_0969 should consider comparative approaches with other bacterial UPF proteins using bioinformatics analysis of conserved domains, structural prediction algorithms, and evolutionary relationship mapping to identify potential functional roles . Experimental approaches might include targeted gene deletion studies, protein-protein interaction assays, and phenotypic analysis of mutant strains to establish the biological significance of this protein family in S. aureus physiology or pathogenicity.

How can researchers effectively design experiments to elucidate the function of SaurJH9_0969?

Designing experiments to elucidate the function of SaurJH9_0969 requires a multifaceted approach that combines genetic, biochemical, and structural methodologies . Researchers should begin with bioinformatic analysis to identify potential functional domains, homologous proteins with known functions, and conserved motifs that might suggest biochemical activities . Gene knockout or knockdown studies in S. aureus JH9 strain could reveal phenotypic changes associated with the absence of SaurJH9_0969, particularly focusing on growth characteristics, virulence, antibiotic resistance, or stress responses . Protein-protein interaction studies using techniques such as co-immunoprecipitation, yeast two-hybrid assays, or pull-down experiments can identify binding partners that may indicate functional pathways . Researchers should design control experiments carefully, using isogenic strains that differ only in SaurJH9_0969 expression, and consider the impact of growth conditions on protein expression and function, as S. aureus adapts its protein expression in response to environmental factors .

What protein-protein interaction methods are most suitable for studying SaurJH9_0969?

For studying protein-protein interactions involving SaurJH9_0969, several methodologies can be employed based on established techniques for S. aureus proteins . Immunoprecipitation using specific antibodies against SaurJH9_0969 followed by mass spectrometry analysis can identify binding partners in their native cellular context . Yeast two-hybrid screening provides an alternative approach for detecting binary interactions, though results should be validated through secondary methods due to potential false positives . For in vitro validation of interactions, pull-down assays using purified recombinant SaurJH9_0969 as bait can be effective, particularly when coupled with techniques such as surface plasmon resonance to determine binding affinities . When designing these experiments, researchers should consider using protein A-depleted cellular extracts or specific blocking agents to prevent non-specific binding to the Fc portion of antibodies, which is a common complication when working with S. aureus proteins due to the natural affinity of many S. aureus proteins for immunoglobulins .

How can researchers investigate the potential role of SaurJH9_0969 in virulence?

Investigating the potential role of SaurJH9_0969 in S. aureus virulence requires a systematic approach combining genetic manipulation, infection models, and comparative analyses . Researchers should first generate isogenic mutant strains with deleted or inactivated SaurJH9_0969 gene and complemented strains where the gene is reintroduced . Phenotypic characterization of these strains should include assessment of classic virulence factors such as toxin production, biofilm formation, and immune evasion capabilities . In vitro infection models using relevant cell types (e.g., epithelial cells, macrophages) can measure bacterial adherence, invasion, intracellular survival, and host cell responses . For in vivo studies, established animal models of S. aureus infection should be employed to compare the virulence of wild-type and mutant strains, with careful monitoring of infection progression, bacterial loads in tissues, and host immune responses . Researchers should also investigate whether SaurJH9_0969 expression is regulated under infection-relevant conditions, such as changes in temperature, pH, oxygen tension, or exposure to host factors, which could indicate a specific role during pathogenesis .

What are the critical considerations for designing expression vectors for SaurJH9_0969?

When designing expression vectors for SaurJH9_0969, researchers must consider several critical factors to optimize protein production and facilitate downstream applications . The selection of promoter strength should be based on whether high expression levels are desirable or if lower expression is needed to prevent aggregation of potentially toxic proteins . Affinity tags should be strategically incorporated, with common options including His-tags for IMAC purification or GST-tags for glutathione affinity chromatography . The position of the tag (N- or C-terminal) should be determined based on structural predictions to avoid interfering with protein folding or function . Codon optimization for the chosen expression system is essential, particularly when expressing S. aureus proteins in heterologous hosts like E. coli, as codon usage bias can significantly impact expression efficiency . Researchers should also include appropriate protease cleavage sites to remove affinity tags if needed for functional studies, and consider incorporating an export signal if secretion of the protein is desired . Control elements such as ribosome binding sites should be optimized for the expression host to ensure efficient translation initiation .

How should researchers design antibodies against SaurJH9_0969 for immunological studies?

Designing antibodies against SaurJH9_0969 for immunological studies requires careful epitope selection and validation strategies . Researchers should begin with in silico analysis of the protein sequence to identify potential antigenic regions, focusing on hydrophilic, surface-exposed segments that are likely to be accessible in the native protein . When designing peptide antigens for antibody production, researchers should avoid regions with high sequence similarity to other S. aureus proteins to minimize cross-reactivity . For polyclonal antibody production, purified recombinant SaurJH9_0969 can be used as an immunogen, while for monoclonal antibodies, defined peptide epitopes might offer greater specificity . Validation of antibody specificity is crucial and should include Western blotting against recombinant protein, wild-type S. aureus lysates, and lysates from SaurJH9_0969 knockout strains as negative controls . Researchers should be aware that S. aureus Protein A binds to the Fc portion of immunoglobulins, which can cause high background in immunological assays; therefore, using F(ab')2 fragments or specifically designed antibodies that don't bind Protein A is recommended .

What analytical methods are recommended for characterizing the purity and integrity of SaurJH9_0969?

For characterizing the purity and integrity of SaurJH9_0969, researchers should employ a combination of analytical methods that provide complementary information about the protein's physical and chemical properties . SDS-PAGE analysis under reducing and non-reducing conditions can assess protein purity and identify potential disulfide-linked aggregates or contaminants . Size exclusion chromatography provides information about the protein's oligomeric state and can detect aggregation or degradation products in solution . Mass spectrometry techniques, particularly ESI-MS or MALDI-TOF, offer precise molecular weight determination and can confirm the protein's identity through peptide mass fingerprinting after protease digestion . For higher-resolution structural analysis, circular dichroism spectroscopy can provide insights into secondary structure content, while dynamic light scattering assesses size distribution and homogeneity in solution . Protein activity assays should be developed based on predicted functions or through comparison with homologous proteins of known function . Researchers should also conduct stability studies under various conditions (temperature, pH, ionic strength) to determine optimal conditions for handling and storage .

How can researchers differentiate between experimental artifacts and genuine functional properties of SaurJH9_0969?

Differentiating between experimental artifacts and genuine functional properties of SaurJH9_0969 requires rigorous experimental design and appropriate controls . Researchers should implement multiple methodological approaches to investigate the same functional property, as convergent evidence from different techniques provides stronger support for genuine findings . Negative controls should include SaurJH9_0969-knockout strains or systems where the protein is absent, while positive controls might involve known functional domains or proteins with established activities similar to those being investigated . Dose-response relationships should be established where applicable, as genuine biological effects typically show concentration dependence . Time-course experiments can distinguish between immediate effects (which might suggest direct action of the protein) versus delayed responses (potentially indicating secondary effects) . When reporting results, researchers should clearly articulate the statistical methods used, including sample sizes, statistical tests, and p values to establish significance . Data variability should be transparently reported using standard error, range, or 95% confidence intervals as appropriate . Finally, researchers should consider alternative explanations for observed phenomena and explicitly address potential confounding factors in their experimental design and discussion .

What statistical approaches are most appropriate for analyzing functional studies of SaurJH9_0969?

The selection of statistical approaches for analyzing functional studies of SaurJH9_0969 should be guided by the experimental design, data characteristics, and specific research questions . For comparing properties between wild-type and mutant strains, parametric tests such as t-tests (for two groups) or ANOVA (for multiple groups) are appropriate when data meet assumptions of normality and homogeneity of variance . Non-parametric alternatives like Mann-Whitney U or Kruskal-Wallis tests should be employed when these assumptions are violated . For dose-response experiments, regression analysis can establish relationships between protein concentration and biological effects . Time-course studies benefit from repeated measures ANOVA or mixed-effects models that account for within-subject correlations . Researchers should clearly define their statistical hypotheses, use appropriate multiple comparison corrections (e.g., Bonferroni, Tukey's HSD) when conducting multiple tests, and report precise p-values rather than simply stating significance thresholds . Power analysis should be conducted prior to experimentation to ensure adequate sample sizes for detecting biologically meaningful effects . When presenting statistical findings, researchers should include measures of effect size alongside significance values to convey the magnitude of observed differences .

How should researchers present SaurJH9_0969 structural and functional data in scientific publications?

When presenting SaurJH9_0969 structural and functional data in scientific publications, researchers should follow established conventions for scientific reporting while ensuring clarity and completeness . Tabular presentation is ideal for comparative data, such as biochemical properties, binding affinities, or activity measurements across different experimental conditions . Tables should be self-explanatory, with clearly defined units for each variable and complete information about sample sizes . Statistical significance should be indicated in footnotes, including precise p-values and the specific tests used . For structural data, high-quality figures showing protein domains, predicted secondary structures, or experimental structural determinations should be included with appropriate labels and scale indicators . When presenting complex relationships or mechanisms, researchers should utilize flow diagrams that clearly illustrate proposed pathways or interactions . All abbreviations used in tables and figures must be explicitly defined in legends, and researchers should ensure numerical data in tables match exactly with values discussed in the text . Following these guidelines ensures that readers can interpret findings accurately without needing to constantly refer to the main text .

What is the recommended format for presenting comparative analysis of SaurJH9_0969 with other bacterial proteins?

The recommended format for presenting comparative analysis of SaurJH9_0969 with other bacterial proteins combines clear tabular data with supporting visual elements and detailed textual explanations . Tables comparing properties across multiple proteins should be organized with proteins as columns and characteristics (molecular weight, isoelectric point, functional domains, etc.) as rows, allowing easy cross-comparison . An example format is shown in Table 1, which demonstrates how such comparative data might be structured .

Table 1. Comparative Analysis of Selected S. aureus Proteins

PropertySaurJH9_0969Protein AProtein XProtein Y
Molecular Weight (kDa)14.54227.331.1
Isoelectric PointUnknown5.16.34.8
Number of Amino Acids129~430245280
Key Structural FeaturesUPF0344 familyFour repetitive domainsβ-barrel structureα-helix rich
Binding PartnersUnder investigationFc portion of IgGCell wall componentsHost fibrinogen
Cellular LocalizationUnknownCell surfaceSecretedCytoplasmic
Role in VirulenceUnder investigationImmune evasionBiofilm formationToxin activity

For sequence homology, multiple sequence alignments should be presented as figures with conserved residues highlighted and accompanied by percent identity/similarity metrics . Phylogenetic trees can effectively illustrate evolutionary relationships between SaurJH9_0969 and homologous proteins from other species or strains . When comparing functional properties, researchers should utilize bar graphs or scatter plots with error bars representing data variability, and clearly indicate statistical significance of observed differences . For structural comparisons, superimposed 3D models or schematic domain organizations provide visual representation of similarities and differences . The accompanying text should systematically analyze patterns in the data, emphasizing both similarities that suggest conserved functions and differences that might indicate specialized roles .

How can mass spectrometry be optimized for studying SaurJH9_0969 post-translational modifications?

Optimizing mass spectrometry for studying post-translational modifications (PTMs) of SaurJH9_0969 requires careful sample preparation and specialized analytical approaches . Researchers should begin with enrichment strategies targeting specific PTMs of interest, such as phosphopeptide enrichment using titanium dioxide or metal oxide affinity chromatography for phosphorylation studies . For comprehensive PTM profiling, a combination of complementary proteolytic enzymes (e.g., trypsin, chymotrypsin, Glu-C) should be used to generate overlapping peptide fragments, maximizing sequence coverage . Fragmentation techniques should be selected based on the PTM type: electron transfer dissociation (ETD) or electron capture dissociation (ECD) are preferable for labile modifications like glycosylation or phosphorylation, while collision-induced dissociation (CID) works well for more stable modifications . Data analysis should employ specialized software capable of identifying modified peptides, with appropriate false discovery rate controls and manual validation of critical findings . When reporting mass spectrometry results, researchers should provide detailed methodology including instrument parameters, database search criteria, and confidence metrics for PTM site localization . Biological replicates are essential to distinguish genuine PTMs from artifacts, and quantitative approaches should be implemented to assess stoichiometry of modifications under different conditions .

What crystallization approaches would be suitable for structural determination of SaurJH9_0969?

For structural determination of SaurJH9_0969, researchers should implement a systematic approach to protein crystallization, beginning with high-purity protein preparations . Initial screening should utilize sparse matrix crystallization screens covering a wide range of conditions (pH, precipitants, additives) at different temperatures (typically 4°C and 20°C) . Both vapor diffusion methods (hanging drop and sitting drop) should be tested in parallel to identify promising initial conditions . Once preliminary crystals are obtained, researchers should perform optimization experiments by varying precipitant concentration, pH, protein concentration, and introducing additives that might improve crystal quality . For proteins that resist crystallization, alternative approaches include surface entropy reduction through strategic mutation of surface residues, truncation of flexible regions identified through limited proteolysis, or formation of protein-antibody complexes to provide additional crystal contacts . If multiple domains are present, expressing individual domains might facilitate crystallization . Researchers should verify crystal content by dissolving single crystals and analyzing by SDS-PAGE or mass spectrometry to confirm they contain intact SaurJH9_0969 rather than degradation products or contaminants . X-ray diffraction should be tested at multiple crystal orientations to assess diffraction quality and anisotropy before proceeding to full data collection .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.